KEGG   Shewanella baltica OS117: Sbal117_3670Help
Entry
Sbal117_3670      CDS       T02013                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbs  Shewanella baltica OS117
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbs00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sbs00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbs02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4243101..4244378
Genome map
AA seq 425 aa AA seqDB search
MLLSTPVWADETGPTKAPSRPKNIVIMIGDGMGPSYTSAYRYYKDNPDTEEVEQTVFDRL
LVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQPLPTILEKAKSLGLST
GVAVTSQINHATPAAFLAHNESRKNYDALALSYLETNADVFLGGGQKYFPPALLEQFKAK
GYQHISRFEDLASITQPKVLGLFAEVQLPWAIDEKDARKLSTLTQKALSLLSQNDQGFVL
LVEGSLIDWAGHNNDIATAMGEMDEFSNAIEVVEQFVREHPDTLMVITADHNTGGLSIGV
DGNYSWNPEILRNISASTDTLALAAITGEQWQADLARGLGFELSEEEVAKLNVARMQGLE
TMAVAIRHLIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQDNTDIANKIFSLLPKP
KKPKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ttgctgttatctacgccagtttgggcagatgaaacgggtccaacgaaagcgccatcgcga
ccgaaaaatatcgtcattatgataggtgatggtatggggccgtcttacaccagcgcctac
cgctattacaaagataatcctgacactgaagaagtcgagcaaaccgtatttgaccgttta
ctggtgggcatggcgagcacctatcccgcgagcgtcagtggttatgtgactgactcagcc
gccgcggcaaccgcactcgccactggggtaaaatcgtataatggggcgatttcggtcgat
acccaaaagcaaccactgccgaccatactcgaaaaagccaaatcccttggcctcagcaca
ggtgtcgcggtaacgtcgcaaatcaaccacgccacaccagccgcctttttggcccacaac
gagagccgtaaaaactacgacgctctggcactcagctatttagaaaccaacgccgatgta
tttttaggcggtggtcaaaaatatttcccccctgcgctattagagcagttcaaagccaag
ggctatcaacacatcagccgttttgaggatctcgccagcatcacccaaccaaaagtgttg
ggcctgtttgccgaagtacaattgccttgggcgattgatgagaaagatgcaagaaaactc
agcaccttaactcaaaaggcactcagcttactgtcgcaaaatgaccaaggttttgtgttg
ttagtcgaagggagtctcatcgactgggcgggccacaataacgatatcgccactgccatg
ggtgagatggatgaattctccaatgccattgaagtggttgagcaatttgtgcgtgaacat
ccagataccctgatggtgatcaccgccgaccacaataccggtggcctatcgattggcgtc
gatggcaactacagctggaaccctgaaatcctgcgtaatatctcggccagcacagacact
ttggccttagccgccatcactggtgaacaatggcaagccgatctcgcccgtggtttaggc
tttgagcttagcgaagaagaagtcgcaaaattaaacgtcgccagaatgcagggattagaa
accatggcagtagcgattcgccatcttattgataaacgtactgatacaggttggacaacc
gacggccacacaggcacagacgtacaagtgtttgccgcaggtccggcgtctgagctgttt
aacggccatcaggacaataccgatatcgccaataagatttttagcttattgccaaaaccg
aagaaacctaaaagctaa

DBGET integrated database retrieval system