KEGG   Shewanella baltica OS117: Sbal117_3843Help
Entry
Sbal117_3843      CDS       T02013                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbs  Shewanella baltica OS117
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal117_3843
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sbal117_3843
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal117_3843
Enzymes [BR:sbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sbal117_3843
Exosome [BR:sbs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal117_3843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4408825..4410462)
Genome map
AA seq 545 aa AA seqDB search
MNKKLLVVAISAMLGLAACGSDGDNGTAGTPGSNGSNGSNGSNGKDWTAVNQWYVDAQAR
VTKAEGLTVNNDVGAAKNVILFVGDGMGVSTITAARILEGQLKGKTGEENSLSFETLPYV
GLSKTYNVDGQTPDSAGTMSAMMTGVKTDVGVISQAEGVVRANCASTKDQNLVTSLELAA
MAGMATGVVTTARLTHATPAATYAHVPERDWEADSNLPAEAVTNGCKDIAAQMLDFNYGS
GLNVMMGGGRRAFIPKTTVDPEGKAGKRNDGRDLTAEWMSKYTNAAYVQDRDGFLSVDAA
STDHLLGLFNSSHMEYDYDRKEAGVTGEPSLAEMTAKSIDILKKNSKGFVLIVEAGRIDH
AHHAGNAARALYDTVALSEAVRVAMEKTSANDTLLMVTADHSHVFTIAGYPTRGNPILGL
VKSNDANGVAEVTNSTDANGLPYTTVGYANGMGYASLATGGDERYNFPVDAGRKDLNFVD
TQSAGFHQEALVPLSDETHAGEDVAIFARGPSSDLIQGTVEQNHIFHVMNRAANLVVKAE
AAAVK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaattactagtagtcgcgatttcagccatgctgggtttagccgcatgcggt
agcgatggtgataacggtaccgcgggaacaccgggtagcaatggatcaaatgggtctaac
ggtagcaatggcaaagattggactgctgtgaatcagtggtatgtcgatgcacaagctcgc
gtgaccaaagccgaaggcttaacggttaacaatgatgttggcgccgcgaaaaacgtgatc
ctgtttgtgggtgacggtatgggtgtatcgaccattactgccgcacgtattttagaaggc
cagctaaaaggcaaaacgggtgaagaaaactcgttatctttcgaaactctgccgtatgtg
ggtctttctaaaacctataacgtcgacggccaaacgcccgattctgcaggcactatgtcg
gcgatgatgacaggtgtaaaaactgacgtgggcgtgatttcacaagctgaaggcgtagta
cgtgctaactgtgcttcgactaaagatcaaaatcttgtgacatcacttgagcttgccgca
atggcgggaatggcaacgggcgtggtaacgactgcgcgtttaacccacgcaactcctgcg
gcgacttacgcccatgtgccagaacgtgattgggaagccgattcaaacctacctgcagaa
gctgtgactaacggctgtaaagatatcgccgcgcaaatgctcgactttaactacggcagc
ggtcttaacgtgatgatgggtggcggtcgccgcgcctttattcctaagacgaccgttgat
ccagaaggtaaagccggtaagcgtaacgatggtcgcgatctcactgctgagtggatgagc
aaatacactaacgccgcttacgtgcaagacagagacggtttcctcagtgtggatgcagca
agcacagatcatttgcttggcctattcaactcatcgcacatggaatacgactacgaccgt
aaagaagctggcgtgactggtgagccatcattggcggaaatgacggctaagtcgattgat
attctgaagaaaaactcaaaaggcttcgtgctgattgttgaagcaggccgtatcgaccat
gctcaccatgcgggtaacgcagcgcgtgcgctgtatgacacagtggcattgtctgaagcg
gtacgcgtggcgatggaaaaaacctcggctaacgataccttgttaatggttacagcggat
cacagccatgtgttcaccatcgcaggttatccaactcgcggtaaccctatcctaggtcta
gtgaagtcgaacgacgccaacggcgttgctgaagtgactaactctaccgatgctaacggt
ttgccatataccacagtcggttacgctaacggcatgggctatgcgtcattagcaacaggt
ggcgatgagcgttacaacttcccagtggacgcaggccgtaaggacttgaactttgttgat
acccaaagtgccggattccaccaagaagccctagtgccattaagcgatgagacccatgct
ggggaagacgtagcgattttcgcccgcggtccaagttcggatcttatccaaggtacggtt
gagcagaaccacattttccacgtgatgaaccgcgcggcaaatttagtggttaaagctgaa
gcggctgccgttaagtaa

DBGET integrated database retrieval system