KEGG   Shewanella baltica OS117: Sbal117_3884Help
Entry
Sbal117_3884      CDS       T02013                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sbs  Shewanella baltica OS117
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal117_3884
   00052 Galactose metabolism
    Sbal117_3884
Enzymes [BR:sbs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sbal117_3884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4464665..4465699
Genome map
AA seq 344 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGILALEVISLGGIIRALWTPDKHGERANIVLGCDS
AEDYLTQSAHLGAIAGRFANRIANGKMHFQGQDYQLDVNQATNCLHGGREGFNRKNWHLG
QLPDGVRLTLMSPDGDMGFPGNCTVQLDYRLAGNNLYVEILASVDKACPVSLTQHSYFNL
DGSETNHEHLMQIDAKRYLTMNDVSVPTGIAETTGSIFDLSQPIRLGDKLHAAELASTRG
YDHCYMMNDSDGSLARFGCLSSPVSGRAMTVYTNQPSVQLYCANFLDGTVGRNQQVLNQH
HGVCLEPQMLPDSPNQGERFGDDVWLVPGKVYHHISRYQFDADA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtttcagtgttttggatccttggaccgatccccgcggcggcgaaatcgaacgg
gttcggatcgacaatggcatactcgcattagaagtcatcagcttaggcggaattatccgc
gctctgtggaccccagataaacacggcgaacgtgccaatatcgtccttggttgcgacagc
gccgaagactacctgacgcaatcggctcacttaggcgccattgctggccgctttgcaaat
cgcatcgctaacggcaaaatgcactttcaaggccaagattatcaacttgatgtcaaccaa
gcgactaactgtttgcacggcggccgtgaagggtttaaccgtaaaaactggcacttaggc
caactgcccgatggtgtgcgcttgaccttaatgagtccagacggcgacatgggtttcccc
ggtaattgcacggttcagctggattaccgcctcgcaggtaataatctctatgtggaaatt
ttggcctcggtggataaagcctgtcccgtgagcttaacccagcacagttatttcaacctc
gatggttcagagaccaatcacgagcatttgatgcaaatcgatgccaagcgttatctcacc
atgaatgatgtcagtgttcccactgggattgccgagactacaggatcaattttcgacttg
agtcagccgatacgcttaggcgacaaactgcatgcagcagaattagcgagcacgcgcggt
tatgatcactgttatatgatgaatgactccgacggttcactcgcccgctttggctgttta
agcagcccagtgagtggccgcgctatgacggtttataccaatcaaccgagcgtgcagctc
tactgcgctaactttttagatggcactgtgggtcgcaatcaacaggtattgaatcaacat
catggcgtgtgtttagagccgcagatgctgccagactcaccgaatcaaggcgagcgcttt
ggtgatgatgtttggttagtgccaggcaaggtttatcaccacatcagccgatatcagttc
gatgccgatgcgtaa

DBGET integrated database retrieval system