KEGG   Shewanella baltica OS117: Sbal117_4071Help
Entry
Sbal117_4071      CDS       T02013                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbs  Shewanella baltica OS117
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sbs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbs00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sbs00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sbs00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4703512..4705503)
Genome map
AA seq 663 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICVAVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAAAPAPVAAPAQAAPASAPVQAAPAPVAAATGATKVVE
VTVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKDVKVAVGD
KVSQGSLVIMLEVGGAAPVAAPTVAAQAAPAATVTPVAAAPAAPAASVVAVKEIQVPDIG
DASNVDVIEVLVSVGDEITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKVSQGSV
IATIETVTAGAAPAPVAQAAAPAPVSAAPIAAPTPASRPPVPHHPSAGTPVSTGAVHASP
AVRRLAREFGVDLTQVAGTGRKGRIMKEDVQAYVKYELSRPKATAATSVGSGNGGGLQVI
AAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRKQQNDV
AAKKKADYKITPLVFMLKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVDTPNGLV
VPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIVNY
PDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGILSDIRT
LVL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtgcaagtgatc
gaaatttgtgtggctgtgggtgataccctagcggcagaagaatcgattcttaccgtcgaa
agcgacaaggcgactatggatattccagcgcctttcgccggtgttttagccgaattgaaa
gtggctgtgggcgataaagtatctgaaggtactttgattgctatgatgcaagcagcgggc
gcggcagctgctgctccggctccagttgcagcacccgctcaggcggcaccagcatctgca
ccagttcaagcggctcctgccccagtggctgctgcgacgggcgcaaccaaagtggttgaa
gtgactgtacctgatatcggtggcgacactgatgtgtcggttatcgaagtcctggttgct
gttggtgacaagattgaagttgatagcggtttaattaccctagaaacagacaaagcgacc
atggacgtaccatcacctttcgcgggtgtggttaaagacgttaaagtcgcagttggcgat
aaagtgtcgcaaggctctttagtcatcatgcttgaagtgggcggcgctgcacctgtagcc
gcgccaactgttgctgcccaagcggctcctgccgctacggtaacgccagtggccgcagca
cctgctgcaccagcggcaagtgtggttgcggtaaaagaaattcaagtgccggatattggc
gatgccagcaatgtcgatgtgatcgaagtgctcgtgtctgttggtgatgaaatcactgct
gaccaaggtttgattacccttgaaactgacaaagccaccatggaagtgcctgcgccattc
gccggtaaactgctgtctttgactgttaaagtgggtgacaaggtttctcaaggtagcgtt
attgcgacgattgaaactgtgactgcaggtgcagctcctgcgcctgttgctcaagcggca
gctcctgctccagtgagcgcggcgcccattgcagccccaacacctgcaagccgtcctcca
gtgccacaccacccaagcgcaggtacgcctgtgtctaccggtgcggtacatgcgtctcct
gcggtacgtcgtttagcccgtgaatttggtgtcgacttgacccaagttgctggtactggc
cgtaaaggtcgcatcatgaaagaagacgtacaggcgtatgtgaaatacgaactgtctcgt
ccgaaagcgactgcggcaacctctgttggttcaggtaacggcggcggtctgcaagtgatt
gcagcacctaaagttgatttcagtaagtttggtgaagtggaagagattccattaagccgt
atccagaagatttcaggtcctaacttacaccgcaactgggtaactatccctcacgtgact
cagttcgatgaagctgatatcactgaaatggaagagttccgtaagcagcaaaacgatgta
gcggcgaagaaaaaagccgattacaagatcacgcctttagtgtttatgctaaaagctgtg
gctaaaacgttgcaacagttcccagtgttcaactcaagcttaagtagcgatggcgaatca
ctgatccagaagaagtatttccatatcggtgtggcggtagatacgccaaacggtttggtt
gtgccagtcgtgcgtgacgtggataagaaaggcattatcgagttatctcgtgaactggct
gatatctctatccgtgcccgtgatggcaagctgaaatctgctgacatgcaaggtagctgt
tttactatttcaagtttaggtggcattggcggtacagcgtttacgcctatcgttaactac
ccagacgtggcgattttaggtgtgtctaaatctgaaattaagcctaagtggaatggtaaa
gagttcgaacctaaattgatgttgccattgtcgctgtcatacgatcaccgcgtgatcgat
ggtgctatggctgcacgctttagtgtgacgctgtcaggaattctgtccgatattcgtact
ttggttctgtaa

DBGET integrated database retrieval system