KEGG   Shewanella baltica OS117: Sbal117_4355Help
Entry
Sbal117_4355      CDS       T02013                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbs  Shewanella baltica OS117
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sbal117_4355
Enzymes [BR:sbs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Sbal117_4355
Transfer RNA biogenesis [BR:sbs03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Sbal117_4355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5017575..5018387)
Genome map
AA seq 270 aa AA seqDB search
MKPEELIDEVIAIATDAGITIRDIYLKGNFEREMKSDNTPVTSADLAANKIICDRLTALT
PDIPVLSEEAADIPLSVRESWKRYWLVDPLDGTGEFIAGSGDFSVIIALVEHNRPVMGVV
YVPMTQVCYYAIAGLGAYKRTDKQEVRISSRQIEHREKVSLRLAVSRRQDPQSVLTLFNH
PKHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQIIVEEAGGQLMDTELQPL
TYNERESLENPNFIVVGAPNLEWDKILIGE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagaagagttgatcgacgaagttattgcaattgcgaccgatgcagggataact
atccgtgacatttatctcaaaggtaattttgagcgagaaatgaagtctgacaatacccct
gtcacttccgcagatttagcggcgaacaagatcatttgtgaccgattgaccgccttaacg
cctgatattcctgtgttatctgaagaagccgccgacattccgttgagtgtgcgtgaatct
tggaagcgctattggttggtcgatccgctcgatggtacgggggagtttatcgccggcagt
ggtgatttttcagtcattatcgcgctggtggaacacaatcgtcccgtgatgggcgtagtt
tatgtgccgatgacacaagtgtgttattacgctattgctggtttaggggcgtacaaacgc
acggataaacaagaagtgcgtattagcagtcgccaaattgagcaccgtgaaaaggtatcg
ctaagattggccgtaagtcgtcgtcaggatcctcaatctgtgttaaccctattcaaccat
cccaaacactgcgagttagtcgttatggggggcgcagcgttaaagagttgtcttgtcgca
gaaggtcgagccgattgttatgtacgagtcggaccaacgggtgagtgggacacgggagct
gcgcaaattatcgtcgaggaagcgggtggacagcttatggatactgagctgcaaccgtta
acctacaatgagcgcgagagcttagagaaccctaatttcatcgtagttggcgcacccaac
ttagagtgggataagattttaataggtgaatga

DBGET integrated database retrieval system