KEGG   Shewanella baltica OS117: Sbal117_4457Help
Entry
Sbal117_4457      CDS       T02013                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbs  Shewanella baltica OS117
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal117_4457
Enzymes [BR:sbs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sbal117_4457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5140620..5142098
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKHIGDDYDIMADLIVNHMSAESPEFKDVLKHGKQSAYWDLFLTKDKVFP
EGLSEQDQAAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSAAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANALGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMDLLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTQLIKLRNSSPAFDGRFTMASAERTLTLSWTAAEAQASLTLDFANKDGQIILLDKQGKE
TQVSLSRLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgcagggctcaaa
gagctcaaagcgctgctcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcgggcttcgatccaatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacacattggtgatgactacgacatc
atggccgaccttatcgttaaccacatgtccgccgaatcaccagaatttaaagacgtgctc
aagcacggcaaacaatcggcttactgggatttatttttaaccaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccgctatctatcgtccgcgtccgggcagttgtttt
agcacttacaccttagccgatggctcgaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccgccgcgggtaaagattatttaaaccgagtgctggcg
cgtttcgaccacagtaaagtgaatctgatccgcttagatgctgcgggttatgcaattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagct
aagcaagccaatgcgttaggtatgacaacgctggccgaaattcattcgcaccacatgact
caggtcgagatcgccaagcgggtcgacatggtgtacgacttcgccctgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggcgccg
cgcaactgcatcaccgtactcgacacccacgacggcatcggcattatcgacgtcggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgat
ttgtatcaaatcaactgcacctattacgatgccctcggtcagaatgacctagattatttg
atggcgcgggcgattcagtttttcgcacccggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggatctgctcaacaacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagctatgcagaaacctgtcgttaaggcg
ctaactcagctgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaactttatcttggacagcggccgaggctcaggcgagtctc
accctcgactttgccaataaagatggccaaatcatccttttagataagcaaggtaaagag
acacaagtgtcgttatcaagactgctggctcaagcataa

DBGET integrated database retrieval system