KEGG   Shewanella baltica OS678: Sbal678_0070Help
Entry
Sbal678_0070      CDS       T01725                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbt  Shewanella baltica OS678
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal678_0070
Enzymes [BR:sbt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sbal678_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(75768..77246)
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKRIGDDYDIMADLIVNHMSAESPEFKDVLKHGKQSAYWDLFLTKDKVFP
EGLSEQDQATIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSAAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANELGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDAGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMELLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTKLIKLRNSSPAFDGRFTMASAERTLTLSWTAADSQASLTLDFANKDGQIILLDRQGKE
TQVSLSKLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgccgggctcaag
gagctcaaagcgctactcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcaggcttcgatccgatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacgtattggtgacgactacgacatc
atggccgaccttatcgttaaccacatgtccgccgaatcgccagaatttaaagacgtgctt
aagcacggcaaacaatcggcttactgggatttatttttaaccaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccactatctatcgtccacgtccgggaagttgtttt
agcacttacaccttagccgatggctccaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccgccgcgggtaaagattatttaaaccgagtgctggcg
cgtttcgaccacagtaaagtgaatctgatccgcttagatgcggcgggctatgcgattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagct
aagcaagccaatgagttaggtatgacaacgctggccgaaatccattcgcaccacatgact
caggtcgagatcgccaagcgggtcgacatggtgtacgacttcgcactgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggcgcca
cgcaactgcattaccgtactcgacacccacgacggcatcggcattatcgacgccggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgac
ttgtatcaaatcaactgcacctattacgatgccctcggtcagaatgacctagattatttg
atggcgcgggcgattcagtttttcgcacccggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggagctgctcaataacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagccatgcagaaacctgtcgttaaggcg
ctgactaaactgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaactttatcttggacagcggccgattcgcaggcaagtctc
accctcgactttgccaataaagatggccaaatcatccttttagataggcaaggtaaagag
acacaagtgtcgttatcaaaactgttggctcaagcataa

DBGET integrated database retrieval system