KEGG   Shewanella baltica OS678: Sbal678_0177Help
Entry
Sbal678_0177      CDS       T01725                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbt  Shewanella baltica OS678
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208726..209538
Genome map
AA seq 270 aa AA seqDB search
MKPEELIDEVIAIATDAGITIRDIYLKGNFEREMKSDNTPVTSADLAANKIICDRLTALT
PDIPVLSEEAADIPLSVRESWKRYWLVDPLDGTGEFIAGSGDFSVIIALVEHNRPVMGVV
YVPMTQVCYYAIAGLGAYKRTDKQEVRISSRQIEHREKVSLRLAVSRRQDPQSVLTLFNH
PKHCELVVMGGAALKSCLVAEGRADCYVRVGPTGEWDTGAAQIIVEEAGGQLMDTELQPL
TYNERETLENPNFIVVGAPNLEWDKILIGE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaagccagaagagttgatcgacgaagttattgcgattgcgaccgatgccgggataact
atccgtgacatttatctcaaaggtaattttgagcgagaaatgaagtctgacaatacccct
gtcacttccgcagatttagcggcgaacaagatcatttgtgaccgattgactgctttaacg
cctgatattcctgtgttatctgaagaggcagccgacattccgctgagcgtgcgtgaatct
tggaagcgctattggttggtcgatccactcgatggcacgggtgagtttattgccggcagt
ggtgatttttcggtgattattgcactcgttgagcacaatcgtcccgtgatgggcgtggtg
tatgtgcctatgacgcaagtgtgttattacgcgattgcaggtttaggggcatacaaacgc
acggataaacaggaagtgcggatcagcagccgccaaatcgagcaccgtgaaaaggtctcc
ctaagattggccgtgagtcgccgtcaggatcctcaatctgtattgaccctgttcaaccac
cctaaacattgcgagctcgtggtgatgggcggcgcagcgttaaagagttgtcttgtcgcc
gaaggtcgagccgattgttatgtgcgagttggcccaacgggcgagtgggatacgggagcg
gcgcaaatcatagtcgaagaggcgggtggacagttgatggatactgagctgcaaccgtta
acctacaatgagcgcgagactttagaaaaccctaactttatcgtagtgggcgcacccaac
ttagagtgggataagattttaataggtgaatga

DBGET integrated database retrieval system