KEGG   Shewanella baltica OS678: Sbal678_0183Help
Entry
Sbal678_0183      CDS       T01725                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sbt  Shewanella baltica OS678
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sbal678_0183
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sbal678_0183
Enzymes [BR:sbt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sbal678_0183
Lipid biosynthesis proteins [BR:sbt01004]
 Desaturase
  First
   Sbal678_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(215107..216213)
Genome map
AA seq 368 aa AA seqDB search
MKKPPIIWLNVSLFAITFLSAVILVPWRGIVHGYGASEWIAFIVLAFASGLSITAGYHRL
WSHKAYKAHPAVRFMYALGGALALQNSALHWASDHRIHHKHVDDNDKDPYSAKMGFWYSH
IGWMLREYQSQRYHDYQNVRDLQNDRIVMWQHKHYLALVLLMNIGLPALLGWLNGDVLSM
LLMAGLLRLVVVHHCTFFINSLAHVWGSQPYTDKNTARDNGFLAMLTYGEGYHNFHHIFE
NDYRNGIKWWHYDPTKWLIKSLSWLGLAKDLRTSPQERIESARLQMQLLRTKNKVVHLPN
ADEIIEKVQAEYELLKLHLMDYYQAKKTLLEAKRKQLVDQQLLQQVEELKARFLVQQKHW
RSLTATYS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccccctatcatctggcttaatgtcagtctgtttgccatcactttcctcagt
gcggtgatcttagttccatggcgcggtattgttcacggctatggcgccagtgaatggatc
gcttttattgtcttagcctttgccagtggtttgtcgatcaccgcaggttatcacagactg
tggtcacacaaggcctataaagcccatccagccgtgcggtttatgtatgcactcggtggt
gctttagcattacaaaacagtgcattacattgggcatccgatcacagaatccaccacaag
cacgtagacgacaacgacaaagacccgtactcagccaaaatgggattctggtacagccat
atcggttggatgctgcgtgagtaccagtcgcaacgctatcatgattatcaaaatgtgcgc
gatctgcaaaatgaccgtatcgttatgtggcaacacaaacattacctcgcactcgttttg
ctgatgaacattggactgcctgccctgctcggctggctgaacggcgacgtactgtctatg
ttattgatggcgggtttactgcgtttagtggtggtgcatcactgcactttcttcatcaac
tctttagcccacgtgtggggcagccagccttataccgataagaacactgcccgcgataat
ggctttctcgccatgctgacctacggtgagggttaccataatttccatcacatcttcgaa
aatgactatcgtaatggcattaaatggtggcactacgatccaactaaatggttgattaag
tcattatcttggttggggttagccaaggacttgcgtacgagtccacaggaacgtatcgag
agcgcacgcttgcagatgcagctgctgcggaccaagaataaagtcgtgcacttacccaat
gccgatgaaattattgaaaaagtccaagctgagtatgaattactcaagctgcacttaatg
gattactaccaagcgaagaaaaccttgcttgaggccaagcgtaaacaacttgtcgatcag
cagctattgcagcaagttgaagagctaaaagcgcgtttcttagtccagcaaaaacattgg
cgaagcctaaccgcaacttatagctaa

DBGET integrated database retrieval system