KEGG   Shewanella baltica OS678: Sbal678_0391Help
Entry
Sbal678_0391      CDS       T01725                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sbt  Shewanella baltica OS678
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal678_0391
Enzymes [BR:sbt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sbal678_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(434773..435423)
Genome map
AA seq 216 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtggacttgaa
accccaatgctcccaagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaagaaatcctgacattaatgtcattggatctgtcagacgatagccttgccgatacg
ccgcgccgcattgctaaaatgtatgtcgatgaaatcttctccggcttagattatgcgaac
ttccctaagatcacggttatcgacaataagatgggcttcgatgaaatggtgcgagtgcaa
gacattagcctcaccagcacctgcgaacaccatttagtgacgatcgatggtactgcgacc
atagcttatctaccacgcaaaaaaatcatcggtttatcaaagattaatcgcatcgtgcgt
ttctttgcccaacgtccacaagtgcaagagcgtttgactcagcaagtgttagtcgcgctg
cagaccttgctcgaaaccaaagacgttgcggttaaaatggatgctgtgcattactgcgtc
aaatcccgtggcgtgatggactcaaccagttcgaccactaccacagcgctgggcggtatt
ttcaaatctaaccctgcgacccgcgccgagtttttgcatcagtctaaataa

DBGET integrated database retrieval system