KEGG   Shewanella baltica OS678: Sbal678_0411Help
Entry
Sbal678_0411      CDS       T01725                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbt  Shewanella baltica OS678
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sbal678_0411
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sbal678_0411
Exosome [BR:sbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal678_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456718..458202
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
IEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQCRRSSEICEQLKAQGL
EEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGELLFGTIDTWLVWKLTEGKVHV
TDPTNAARTLLFNIHSLTWDNKLLEALNIPLSLLPEVKPSCSVYGTTRIAGEGSEIQVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRSNHGLLTTVAVGPKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GAIFGLTRGANRNHIIRAALESIAYQSKDLLDAMTKDSGVSLKRLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIELEHKACIDKHFIPNIDAETRVR
LYAGWQDAVARTRA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatacgtggtggctttagatcaaggcacgaccagctcaagggcgatagtg
ttcgatcacgatgcaaacattgtcagcgtgtcccagcgggaattcacccagttgtatccg
aatccgggttgggtcgagcatgatcccatggagatctgggcaagccaaagttcagtatta
attgaagtgctggcgcgcgcggggatccacagcgatgaagtggccgcgattggcattacc
aatcagcgggaaactacagtcatttgggagaaagccacaggtaaacctatctataacgcg
attgtgtggcagtgccgtcgtagctctgaaatttgtgagcaactcaaagctcaaggatta
gaagagtatgtccgtgaaaacacaggcctgttactcgacccttatttttcaggcactaag
atcaagtggattctagataatgtgcccaatgcccgtgcgcaagccgagcgcggtgagttg
ttgttcggcactatcgatacttggctagtgtggaagttaaccgagggcaaagtgcatgtc
accgatcccaccaatgccgcccgtactctgctgtttaatatccatagtctgacttgggat
aacaagttacttgaagctttaaacattcccttgtctttattgcccgaagttaagccttcc
tgcagtgtctatggcaccacacggattgccggtgaaggcagtgaaatccaagttgcagga
atggcgggcgaccaacaggctgcgctttttggtcagttgtgtgtcgagcctggcatggcg
aagaatacctatggcactggctgttttttattgatgaataccgggaccaaagcggtgcgc
tctaaccatgggttactgaccacagttgccgtgggaccgaagggcgaagtgaactatgcc
ctcgaaggttcagtcttcatgggtggcgcgactattcaatggctgcgcgatgaacttggg
cttattcgtgacgccagtgatactgagtattttgcctctaaggttgctgataccaatggc
gtgtatttagtgcccgcttttgttggactcggggcgccctattgggatcccaatgcccgt
ggcgcaatctttggtttaacccgtggcgccaaccgtaatcatattattcgggcggcgtta
gaatccattgcttatcagagtaaagatttactcgatgccatgaccaaagacagtggcgtt
agccttaagcgtttgaaggtggatggcggcgcggtcgccaatgattttttgatgcagttt
caagccgatatcaccgatgtcgaagtactaaggccgagtgtttgtgagacaacggctttg
ggcgcggcatttttagctgggttggctgtgggcttttgggagagtgtcatagagcttgaa
cataaagcttgtatcgataagcattttatccccaatattgatgccgagactcgggtgcgg
ttatacgcaggttggcaagatgccgtcgccagaactcgcgcctaa

DBGET integrated database retrieval system