KEGG   Shewanella baltica OS678: Sbal678_0417Help
Entry
Sbal678_0417      CDS       T01725                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sbt  Shewanella baltica OS678
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sbal678_0417
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal678_0417
Enzymes [BR:sbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sbal678_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462944..464443
Genome map
AA seq 499 aa AA seqDB search
MMLLRDLLAPWLHYAGAQSFSDLTLDSRAIRRGDVFLALPGHKVDGRQFIEKALDLSAAA
VLVHTDDADQHGKVLHSDNAEHGVQIYVFQLSRQVSAIAAQRYPLAHQSATTSLGVIGIT
GTNGKTSTSQLIAQLITSLGRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHDFEAQ
GASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYAAAKQSLFRFSTLG
HGLLNLDDAVGASWLTELKSVPAQMWGFSIEGHQAAAFYTKNAKFDDQGVSATLVWPEGE
TQIHSPLLGAFNLSNLLAALSALYLQGFDMKALAEQVQYLTPVAGRMERFTTANNITLVV
DYAHTPDAIEQALNALRRHCVGDLWCVFGCGGDRDKGKRPLMGQAAEQYADRIMVTSDNA
RSEDPAQIITDIIQGLTHPQQALTQVDRIAAIKEVVALAKPGDVILLAGKGHETYQEAAG
VRHDYDERALARQLSEQSR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattacgggatctgctcgcgccttggctgcattatgccggcgcgcagtccttc
agcgatttgaccttagatagccgcgcaatacgtcgcggcgatgtgtttttggcgctgcca
ggacataaggttgatggcagacagtttattgaaaaagccttagatttaagtgccgcagcc
gtattagtccacacggatgatgctgatcagcatggcaaagtgttgcacagcgataatgcc
gagcacggcgtacagatttatgtcttccagttgagtcgccaagtatcagccatcgccgcc
cagcgttatcccttagcgcatcagtctgcgacaacatcccttggggtgattggtattact
ggcaccaatggtaaaacctcgacaagccaactgattgcccagctgataacgtcgctcggc
cgcaaagccgccgtgatgggcacccttggcaatggactctggggcgagctcgtcgatagc
ggtaacaccacagccgatgcgattaccctaatgcgtcagttgcatgactttgaagcccaa
ggcgcgagtgtttgcgccatggaagtgtcgagccacggcttagtgcaaggccgcgtcgat
gcagtaccattcgatgttgccgtgtttaccaatctgacgcgcgatcacctcgattaccac
ggtgatatggaaagctatgccgccgctaagcaaagcctatttcgtttcagcaccttaggt
cacggtttattgaatcttgacgacgcggttggtgcatcttggttgactgaacttaaatct
gtgcccgcgcaaatgtggggctttagtattgaaggtcatcaagccgcggctttttatact
aaaaatgccaagtttgacgatcaaggtgtcagtgcaaccttagtctggcccgagggcgag
actcaaatccactcaccacttcttggtgcctttaatctctctaatttactcgcggcgctc
tcagccttgtatctgcaaggttttgatatgaaagcgttagccgagcaagtgcaataccta
acgcccgtcgcaggtcgtatggagcgtttcacaactgcgaataacattaccttagtggtc
gattatgcccatacgccagatgcgattgaacaagcgttaaacgcgctacgtcgacattgt
gtcggtgatttatggtgcgtatttggctgtggtggcgaccgtgataagggcaagcgtcct
ttgatgggccaagctgcagagcaatatgctgaccgcattatggtgacgagcgacaatgcg
cgcagtgaagaccccgcgcaaattattaccgatattatccaagggctaacccaccctcag
caggcattgactcaggttgaccgtatcgcagcaattaaagaggttgtggcattggcgaaa
cctggcgatgtgatcttgcttgcgggtaaaggccacgaaacttaccaagaggcggcaggt
gtgcgtcatgactatgatgaacgcgccctggcacgccagttatcggagcaatcaagatga

DBGET integrated database retrieval system