KEGG   Shewanella baltica OS678: Sbal678_0431Help
Entry
Sbal678_0431      CDS       T01725                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sbt  Shewanella baltica OS678
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sbal678_0431
Enzymes [BR:sbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sbal678_0431
Exosome [BR:sbt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal678_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(487234..488241)
Genome map
AA seq 335 aa AA seqDB search
MNIITSAFPQRRMRRMRKHDFSRRLMAENQLTVNDLIYPMFVLEGTNRSEKIASMPGIER
YSIDLLLKEAEELVELGIPLIALFPVTPAEKKTLMAEEAYNADALVQRAVRELKKAFPQL
GIMTDVALDPFTTHGQDGIIDETGYILNDITTEILVKQALSHAEAGADIVAPSDMMDGRI
GAIRQALEAAGHVNTQIMAYSAKYSSSYYGPFRDAVGSAGNLKGGNKHSYQMDPANSDEA
LHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAYQVSGEYAMHMAAIQNGWLA
EKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatcattaccagtgccttccctcagcgtagaatgcgccgcatgcgtaaacatgat
tttagccgtcgtctcatggccgaaaatcaactaacggtcaatgacttgatttatcccatg
tttgttctagagggcaccaatcgcagtgaaaagatagcctctatgccaggtattgaacgt
tactcaatcgatttactactaaaagaagccgaagaactggttgagttaggcatcccatta
attgcgctcttccctgtgacgcctgcagagaaaaagaccttaatggcagaagaagcttat
aatgccgatgccttagtgcagcgtgctgtacgtgagcttaaaaaagcctttccacagctt
ggcatcatgacagacgtagcattggaccccttcaccactcatggtcaagacggcatcata
gatgagactggctacatcctaaatgacatcaccaccgagatcttagtgaagcaagcattg
tcacacgccgaagccggtgcagacatagttgcaccgtcggacatgatggatggccgcata
ggcgctattcgccaagccttagaagcagcaggccacgtaaacacccaaatcatggcttac
tcagcaaaatactcttcaagctactacggcccgtttcgtgacgcagtaggctcagcaggc
aatctcaaaggcggcaataaacacagctaccagatggatcctgcaaacagtgacgaagct
ctgcatgaagtcgcactcgatattcaagaaggtgccgacatggttatggttaagccaggc
atgccgtatttagatatagtgcaccgcgttaaaactgaacttgccgtgccaacattcgcc
tatcaagtcagtggtgaatacgccatgcacatggccgccatccaaaatggttggttagcc
gaaaaagccatcgtcatggaatctctactttgctttaagcgcgcaggcgcagacggtatt
ttaacttacttcgctaaacgtgccgcacagtggcttaaagaagcttag

DBGET integrated database retrieval system