KEGG   Shewanella baltica OS678: Sbal678_0864Help
Entry
Sbal678_0864      CDS       T01725                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbt  Shewanella baltica OS678
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbt00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sbt00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbt02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(982722..984041)
Genome map
AA seq 439 aa AA seqDB search
MSFTKAPLLLLGISLLLSTPVWADETGPTKAPSRPKNIVIMIGDGMGPSYTSAYRYYKDN
PDTEEVEQTVFDRLLVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQPL
PTILEKAKSLGLSTGVAVTSQINHATPAAFLAHNESRKNYDALALSYLETNADVFLGGGQ
KYFPPALLEQFKAKGYQHISRFEDLASITQPKVLGLFAEVQLPWAIDEKDARKLSTLTQK
ALSLLSQNDQGFVLLVEGSLIDWAGHNNDIATAMSEMDEFSNAIEVVEQFVREHPDTLMV
ITADHNTGGLSIGVDGNYNWNPEILRNISASTDTLALATITGEQWQADLARGLGFELSEE
EVAKLNVARMQGLETMAVAIRHLIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQDN
TDIANKIFSLLPKPKKPKS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaccaaagcgccactcttgttactcggcatcagtttgctgttatctacgcca
gtttgggcagatgaaacgggtccaacgaaagcgccatcgcgaccgaaaaatatcgtcatc
atgataggtgatggtatggggccgtcttacactagcgcctaccgctactacaaagataat
cctgacactgaagaagtcgagcaaaccgtattcgaccgtttactggtgggcatggcaagc
acctaccccgcgagcgtcagtggttatgtgactgattcagccgcggccgcgacagcgcta
gccacaggggttaaatcttataatggggcgatttcggtcgatacccaaaaacaaccgctg
ccgaccatactcgaaaaagccaaatcccttggcctcagcacaggtgtcgcggtaacatcg
caaatcaaccacgctacgccagcggcctttttggcccacaacgaaagccgtaaaaattac
gacgctctggcactcagctatttagaaaccaacgccgatgtatttttaggcggtggtcaa
aagtatttccccccagcgctgttagagcagttcaaagccaagggctatcagcacatcagc
cgttttgaggatctcgccagcatcacccaaccaaaagtgttgggcctgtttgccgaagta
caattgccttgggcgattgatgagaaagatgcaagaaaactcagcaccttaactcaaaag
gcactcagcttactgtcgcaaaatgaccaaggttttgtgctgttagtcgaagggagtctc
atcgactgggcgggccacaataacgatatcgccactgccatgagtgagatggatgaattc
tccaatgccattgaagtggttgagcaatttgtgcgtgaacatcccgataccctgatggtg
atcaccgccgaccacaataccggtggcctatcgattggcgtcgatggtaactacaactgg
aaccctgaaatcctgcgtaatatctcggccagcacagacactttggccttggccaccatc
actggtgaacaatggcaagccgatctcgcccgcggtttaggctttgagcttagcgaagaa
gaagtcgctaaattgaacgtcgccagaatgcagggattagaaaccatggcggtggcgatt
cgccatcttattgataaacgtactgatacaggttggacaaccgacggccacacaggcaca
gacgtacaagtatttgccgcaggtccggcatctgagctgtttaacggccatcaagataat
accgatatcgccaataagatttttagcttattacctaaaccgaagaaacctaaaagctaa

DBGET integrated database retrieval system