KEGG   Shewanella baltica OS678: Sbal678_0903Help
Entry
Sbal678_0903      CDS       T01725                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sbt  Shewanella baltica OS678
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal678_0903
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sbal678_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040650..1041138)
Genome map
AA seq 162 aa AA seqDB search
MPRVYVALGANLEDPKAQLDNAVTALSALALGDSLLVSPYYHSTPMGDVVQPDYVNAVAS
FDTDLEPLALLDALQHIENTQGRVRLERWGPRTLDLDLLLYGNENIDIPRLKVPHYGMKE
RSFVLVPLAAIAPNLILPCNTAIGSLIDTKMLAELQQLGIDH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtgtctacgtcgcattaggcgcaaatcttgaagatcccaaggctcaattggac
aatgccgtcacggcattgtccgcattagccttaggcgatagtctactggtttccccctat
taccattcgacgcccatgggcgatgtggtgcaacccgattatgttaatgcggtggccagt
ttcgatactgatcttgagccattagccttactcgatgcattgcagcatatcgaaaacacc
caaggacgagtgcgccttgaacgttgggggcccagaaccttagatctcgatttactcttg
tatggcaatgagaacattgatattcccagactcaaagtgccccactacggcatgaaagag
cgcagctttgtgctcgtacctttagccgcaatcgcaccgaatcttattctgccgtgcaac
actgcaatcggcagtcttatcgatacaaaaatgttggccgagttacaacaactgggtatt
gatcattga

DBGET integrated database retrieval system