KEGG   Shewanella baltica OS678: Sbal678_1101Help
Entry
Sbal678_1101      CDS       T01725                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sbt  Shewanella baltica OS678
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal678_1101
   00670 One carbon pool by folate
    Sbal678_1101
Enzymes [BR:sbt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sbal678_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1272421..1272903
Genome map
AA seq 160 aa AA seqDB search
MRIAMIAAMSNNRVIGKENKMPWHLPEDLRHFKAMTLGKPVLMGRKTFESIGRPLPGRHN
IVISRQTDLVIEGVTCVTSFDAAKQAAGECEELVVIGGGQLYAELLPYADTLYLTQIKLE
VEGDTFFPHWDDGTWKETESLSSINADGLEYRFINLVKKC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgctatgatagccgcgatgtcaaacaatcgagtcatcggaaaagagaataaa
atgccatggcatcttccagaagatctacgtcactttaaagccatgaccctaggtaagcct
gtgctgatggggcgtaagacctttgagtccattggtagaccccttcctggtcgacataac
atagtgatttcacgtcaaacggatctcgtcattgaaggcgtgacctgtgtgacctctttt
gatgcagccaaacaagccgctggcgagtgtgaagagttagtggtgattggtggcggtcag
ctttatgccgagttattaccttacgcagataccttatatttgacgcaaatcaagctagag
gttgagggtgatacatttttcccccactgggatgacggaacttggaaagaaacggaatct
ttgtctagtataaatgcggatggtttggaatatcgctttatcaatttggtaaaaaaatgt
taa

DBGET integrated database retrieval system