KEGG   Shewanella baltica OS678: Sbal678_1205Help
Entry
Sbal678_1205      CDS       T01725                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbt  Shewanella baltica OS678
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal678_1205
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sbal678_1205
Enzymes [BR:sbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sbal678_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1395118..1397916
Genome map
AA seq 932 aa AA seqDB search
MNKTLSASAILLALGLAACSEAPVTPSSASANKAVTQTQQAQDALTQAQLQQLGDSLVVT
YRVVTNVPDDKCLKDKADGRCFVAQIDFVPGMDLASQDWEIYLSQMRPVQSVESGELTIT
HVKGDLHRITPTAAFKGFVKGEKKQLTFRGEPWQLAETDAMPNYYLAANGLEPVIIASTQ
VGKDAETGLETRPYVEGFTNFKTQYQRTETDKLAPADAAQLFKANQSVSEDAALAVDTII
PTPQKVKIHSTDTPVSLAGGIKVEYQQDNPEQKSQVAAAVARLARLGVAESASGITVKFA
SQKGDEGSYRLDIQPTEIVIAANDAAGFSYGLSSLASLVDVNSLKVNAMTIEDSPRYPFR
GMHIDVARNFHSKQLLLDLLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTDIGSKRCH
DLDENSCLLPQLGSGPFGDTSVNGYYTKQDYIDIVKYAEARQIQVIPSMDMPGHSRAAIK
AMDARFRRLQSEDVELQNTGKVQVVPVQETVNQASTAVKALDAGARQLQAEGKTTAAEQY
LLSDANDKTVYSSVQYYDDNTLNVCMESTYQFVDKVIDEIAKLHQAAGQPLTRYHIGADE
TAGAWKQSPQCLAFVANNDKGVKSIDDLGAYFIERISTMLAAKGIEAAGWSDGMSHVRPE
NMPAKVQSNIWDVIAHKGYERANQQANLGWETVLSNPEVLYFDFPYEADPKEHGYYWASR
ATNSHKVFSFMPDNLAANAEQWTDIQNQPFEADDRIKLDEAGKKISGPREKGKPFTGLQG
QVWSESIRSDDTIEYMVFPRLLMLAERAWHQAAWEVPYQYQGAIYNQSSRAFTLAMRDAQ
AKDWQQLANTLGHKEFIKLDKAGIDYRVPTVGAEIREGKLFANIAYPGLKLEYRSLNGQW
QAYQAGQAVTAPIEVRAIAADGIRKGRSLIVN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacactctcagcaagcgccattttactggctttaggattagcggcctgttcc
gaggcgccagtgacgccttcctctgcgtcagccaataaggctgtgactcaaacacagcaa
gctcaggacgcattaactcaagcgcagttacaacaactcggggattcgttagtcgtaact
taccgtgttgtgaccaatgtgccagacgataagtgcctaaaagataaagccgatggtcgc
tgttttgtcgctcaaattgatttcgtgcccggtatggatttagccagccaggattgggaa
atttatttaagccaaatgcgcccagtgcaatcggttgaaagcggtgagttgacgataacg
cacgttaaaggcgatttacatcgtattacgccaacggccgcttttaagggatttgttaag
ggcgagaaaaagcaactgacattccgtggtgagccgtggcaattggctgaaaccgacgct
atgccaaactattacctcgcagcaaacggattagaacccgtcattatcgccagcactcaa
gtgggtaaagatgccgaaacgggtttagagacgcgtccgtatgttgaagggtttacgaat
tttaaaacccaatatcaacgcactgaaacggataaactcgcgccagccgatgccgcgcaa
ttatttaaagccaatcaaagcgtgagtgaagatgccgccttggctgtggataccattatc
ccaacgccacaaaaggtgaagatccattcaactgatacaccagtatcccttgctggcggt
attaaggtcgaatatcagcaagataacccagagcaaaagagtcaagttgcggcagcggtg
gcacgtttagctcgcctgggtgtggctgaatctgcgagtggcattacggtgaaatttgcc
agccaaaaaggggatgagggcagttatcgcttagatattcagccaactgaaatagtgatc
gctgccaatgatgcggcgggcttctcttacggtttgtcatcattagcaagccttgtggat
gtgaattcgctgaaagtgaatgccatgaccattgaagacagcccacgttatccgttccgt
ggtatgcacattgatgtggcacgtaatttccacagcaaacaattgttgctggatttgctc
gaccaaatggcggcttataagctcaataaactgcatttacacatggctgacgatgaaggt
tggcgtttagaaatcgatggtctgcctgaattaaccgacattggcagtaaacgttgccat
gatttagatgaaaattcctgcttattaccgcagttaggcagtgggccgtttggcgatact
agtgttaatggctattacaccaaacaagactatatcgacatagtgaaatatgccgaggcg
cgtcaaattcaagtgatcccatcgatggatatgccgggtcatagccgcgccgcgattaaa
gcgatggatgcgcgttttcgtcgattacagtctgaagacgtagagcttcaaaacacgggc
aaagtgcaggttgtccctgtgcaggaaacggtaaatcaagctagcacagcggtaaaagcg
ttagatgcgggcgctcgtcaattgcaagctgaagggaaaaccactgcagctgagcaatat
ttgttatccgatgcaaacgacaaaacggtttattcttcagtgcaatattacgacgacaat
acgcttaacgtgtgtatggagtcgacctatcagtttgtcgataaggtaattgatgaaatt
gccaagttacaccaagccgcgggtcaaccattgacgcgttaccacattggtgccgatgaa
acggcgggagcttggaaacaatcaccccagtgtttagcatttgtcgccaataacgataaa
ggcgttaagtcgatagatgacttaggcgcttattttatcgagcgaatttcgactatgtta
gcggccaaaggtattgaagctgcggggtggagcgatggcatgagccatgttcgccctgag
aatatgcccgctaaagtgcagtctaatatttgggatgtgattgcccataaaggctatgag
cgcgccaatcagcaggcgaatcttggttgggaaaccgtgctctctaatcctgaggtgttg
tactttgatttcccctatgaggccgatcctaaggagcatggctattactgggcgagtcgc
gcgaccaacagccataaagtctttagctttatgccagataacttggccgccaatgccgag
caatggaccgatattcaaaatcagccgttcgaagcggacgacagaataaaacttgatgag
gcgggtaaaaaaatctcgggtccaagggagaaaggcaaaccttttactggcttgcaaggg
caggtttggagtgagtcgattcgcagtgacgatacaattgaatacatggtgttcccgcgt
ttgttgatgttggctgagcgtgcttggcatcaagccgcatgggaagtgccttatcaatat
caaggcgctatatataatcaaagctcgcgcgcttttactttagccatgcgtgatgcacag
gcaaaggattggcaacaactcgcgaatactttaggccacaaagagtttattaagttagat
aaagcggggattgattatcgcgtaccgacggtcggcgccgagatccgtgaaggtaaactg
tttgctaatatcgcctatcccggactcaaactggaataccgaagcctaaatggccaatgg
caagcttatcaagcggggcaggcggtcactgcaccgattgaggtccgtgccatagctgcc
gatggtattcgtaaaggccgaagtttaatcgttaactaa

DBGET integrated database retrieval system