KEGG   Shewanella baltica OS678: Sbal678_1374Help
Entry
Sbal678_1374      CDS       T01725                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbt  Shewanella baltica OS678
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal678_1374
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal678_1374
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal678_1374
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal678_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1599179..1600828
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAIPGSLFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAVVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacgcttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgagtttgccgacgaagtaccagcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctattcgtgatggtgcatggcaaattcgcggtattcccgatgacttg
cttgaccgccgtgtagaaatcacaggtcccgttgaacgtaagatggtgattaacgcactc
aacgccaatgccaaagtgtttatggccgatttcgaagattccttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggatacaggtaagcactacaaattaggaccaaatccggcagtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaatggcaaagcgattcctggc
tcactgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggt
agcggtccatacttttatatccctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctacgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgtgttttaccggatcgccaagccgtcactatggatacgcct
ttcttaagcgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagct
atgggcggtatggcggcctttattccagccaaagatccggttcagaacgaagcggtattg
cagcgagttcgtcgagataaagaactagaggcgcgtaacggccacgatggcacttgggtg
gcgcacccaggtcttgccgataccgctatggggattttcaacgaatacataggccaagat
cactgtaatcaattacatattacccgtgatgtagacgcgccaattctggctagcgaactg
cttaaaacctgcgacggtgagcgcactgaacaggggatgcgcctgaacattcgtatcgca
ctgcagtatttagaggcgtggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcggcgacggctgagatttctagagcctcaatttggcaatggatccaacacggt
aagtcgttatcaaacggcaaactcgtgaccaagcaactctttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggtggtattgctcgaagacattaccacctccgacgagctggtcgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system