KEGG   Shewanella baltica OS678: Sbal678_1374Help
Entry
Sbal678_1374      CDS       T01725                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbt  Shewanella baltica OS678
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal678_1374
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal678_1374
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal678_1374
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal678_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1599179..1600828
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAIPGSLFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAVVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacgcttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgagtttgccgacgaagtaccagcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctattcgtgatggtgcatggcaaattcgcggtattcccgatgacttg
cttgaccgccgtgtagaaatcacaggtcccgttgaacgtaagatggtgattaacgcactc
aacgccaatgccaaagtgtttatggccgatttcgaagattccttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggatacaggtaagcactacaaattaggaccaaatccggcagtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaatggcaaagcgattcctggc
tcactgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggt
agcggtccatacttttatatccctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctacgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgtgttttaccggatcgccaagccgtcactatggatacgcct
ttcttaagcgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagct
atgggcggtatggcggcctttattccagccaaagatccggttcagaacgaagcggtattg
cagcgagttcgtcgagataaagaactagaggcgcgtaacggccacgatggcacttgggtg
gcgcacccaggtcttgccgataccgctatggggattttcaacgaatacataggccaagat
cactgtaatcaattacatattacccgtgatgtagacgcgccaattctggctagcgaactg
cttaaaacctgcgacggtgagcgcactgaacaggggatgcgcctgaacattcgtatcgca
ctgcagtatttagaggcgtggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcggcgacggctgagatttctagagcctcaatttggcaatggatccaacacggt
aagtcgttatcaaacggcaaactcgtgaccaagcaactctttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggtggtattgctcgaagacattaccacctccgacgagctggtcgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system