KEGG   Shewanella baltica OS678: Sbal678_1387Help
Entry
Sbal678_1387      CDS       T01725                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbt  Shewanella baltica OS678
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal678_1387
Enzymes [BR:sbt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Sbal678_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1614765..1617191
Genome map
AA seq 808 aa AA seqDB search
MGLEKLLYLRGVGAEFTDCFGQEIHISEVDRQGILTCMLQEKNTVAGTAIDASATEALSS
DAGLTNVDAVLTEALIASQIDLLDARPWTQVLPEFHWCFVDEPWISLCLPETYTSDLSVA
IECEQGESIVFDVPFSALKSIGDYRIEQTLYLHYRLDLTQLGLARLDLAEAKTQASPEHS
MPAETEAVNLASYFLSSQEFTNNPALIKNQDSFAHAADKNASDFSVLGLGFHRIALSLKH
ALETSAPAPSSSLQSSVTAEADTSTLFSGTLMVAPRAAYQGVLTAVAQGKRHKPWGISVQ
LYSLRSESQWGIGDFGDLEQLIALVAAQGADFILLNPLHALDIAAPEHPSPYSPCDRRRL
NPLYIQLQSVPEYQALTTEFSSATWIEAIALLNRDNWLDYPKVSELKYRAFEQLYRVFCE
THLANDTPRAQRFHEFVREQGTALQEFAQAEYLRSPKAFVQEEGFYLYLQFVAENQLHLC
QLKAKEVGMGLGLIRDLAVGAALQGSEVQANAEQFCLHASIGAPPDPFAPQGQNWGLTPL
DPVKLKQHNFSHFIALIRANMESCGALRIDHVMGLLRLWWWPLDKQLGHGAYVYYPVETM
LAIVCLESQRARCVVIGEDLGLVPPDIIHRLYTSGIYSNELFYFCKDHQGFKSPDQYKSQ
SLMMLANHDVPTLVAWWCGSDLHLRRQLSLFDSDEQLGDALAGREHEKQQLISLLVAQGL
LAEVTIAELDIQTLLTAWMTLGARGNSALYSVQLCDLLADRHAVNIPGTWLEYPNWQRRL
PLSLTQVSASPEILQRLQNIAAARQLPS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaaaagttgctgtatttgcggggggttggagcagaatttactgattgtttt
ggccaagagatccatatttccgaggtagacaggcaaggtattttgacctgtatgttacag
gaaaaaaacactgtggcagggactgccattgatgcttctgctacagaggcgttatcgagt
gatgctgggctgactaacgtcgatgcggtattgaccgaagcgctgatcgcctcacaaatt
gacttgctggatgcccgtccttggactcaggtgttacccgaattccattggtgttttgtg
gatgaaccttggataagcctttgtttacccgaaacctatacctcagatctgagtgtggct
attgaatgcgaacagggtgagtctatcgtatttgatgtgccgttctcggcgcttaagtcg
attggcgattaccgtattgaacaaacgctttatctccattatcgccttgatcttacgcaa
ctgggattagcacgcctcgatttagctgaggctaagacccaagcttccccagaacactca
atgcccgctgagactgaggcggtgaatttagcgtcttatttcttgagcagccaagagttc
actaacaatccagccttgatcaaaaaccaagactcatttgcgcatgcagctgacaaaaat
gcgagtgatttctctgtgttaggtttgggctttcatcgcatagctttaagcttaaaacat
gctctagagaccagtgcaccagcgccaagctcgtcgctacagagcagtgtgacggcagag
gctgataccagcaccttgttttctggcaccttaatggtggcaccgcgggccgcttatcaa
ggcgtactcacggctgtcgcccaaggtaagcgccataaaccttgggggatcagcgttcaa
ctctacagtttacgcagcgagagccagtggggcataggtgactttggcgatttagaacaa
ctgatcgcgctggtggcggcgcagggcgcggatttcattctactcaatcccttgcatgcc
ctcgacattgcggcgccagagcatccgagtccctatagtccgtgcgatcgccgcagactc
aatcctctttatattcaattacaaagcgttcctgaataccaagcacttaccactgaattt
tcaagcgctacttggatagaggccatcgccttactgaatcgtgacaattggctcgattat
cctaaggtgagtgagctcaaataccgtgcctttgagcagttatatcgcgttttttgtgaa
acccatttagcaaacgacacgcccagagcgcaaagattccatgagtttgtgcgtgagcag
ggcactgcgctgcaagagtttgctcaagcggaatacttacgtagcccgaaagcgtttgta
caagaggaaggtttctatctttacctgcaatttgtggccgaaaaccagttacacctttgc
cagctaaaagcgaaagaagtgggcatggggttgggattaatccgtgatttggccgttggc
gcagcgctgcagggcagtgaagtacaggccaatgccgagcagttttgtttgcatgccagt
atcggcgcaccgccggatccctttgccccccaagggcaaaattggggcttaacgcccctc
gatccggtgaagttaaaacaacataatttcagtcattttattgccctgatccgtgccaat
atggaaagctgtggcgccttgcgtatcgatcatgtgatgggcttactgcgcctctggtgg
tggccactggataaacaactcggccacggtgcctatgtgtattatcccgttgaaaccatg
ctcgccatcgtttgccttgagagtcaacgcgcccgctgtgtggtgattggtgaagactta
gggctagtgccaccggacattattcatcgtctctacacttctggcatttactccaacgaa
ttgttctatttctgcaaagaccatcaaggctttaaatcaccggatcaatacaagtcccag
agcctgatgatgctggcgaaccacgatgtaccgactttagtggcttggtggtgtggcagc
gatttgcacctgcgtcgacagttatccctatttgattctgacgaacaattgggcgatgcg
ctcgcagggcgggagcatgaaaagcagcagcttatttcactgttagtcgctcaaggtctg
ttagccgaggtgacgatagccgaactcgatattcaaaccttgctcacggcttggatgacc
ctaggtgctcgcggaaatagtgcgctgtacagcgtgcaactgtgtgatttattagccgat
cgccatgcggtgaacattcccggcacttggctcgaatatcctaactggcagcgccgcttg
ccgctgagtttaacgcaagtgtcggcttcgccggagatactgcagcgattacaaaatatc
gctgcggcgagacagctgccgagctaa

DBGET integrated database retrieval system