KEGG   Shewanella baltica OS678: Sbal678_1442Help
Entry
Sbal678_1442      CDS       T01725                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbt  Shewanella baltica OS678
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sbal678_1442
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sbal678_1442
Enzymes [BR:sbt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sbal678_1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1689038..1689523)
Genome map
AA seq 161 aa AA seqDB search
MTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKDQGLVI
LGFPCNQFGAQEKADEQGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKAAPGVLG
TQGIKWNFTKFLVNRRGEAIERFASTTKPEALESKIAALLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactacgaatatatacagccaatcagcgacagacattcaaggcaacacagtaagttta
gagcagtatcgaggcaaagtactcttgatcgtcaacaccgccagtgaatgtggatttaca
ccgcaatacaagggattagaagcgttatatcaagaatataaagatcaaggattagtgatt
ttaggctttccttgcaatcaatttggcgcccaagaaaaagccgatgagcaaggtattcaa
gccttttgtgaattgaattttggcgtgacgtttccgctattttctaaaatagaagtgaat
ggcgaacatacccatccactttatcaataccttaagaaagccgctcccggtgtattaggt
actcaaggtatcaaatggaatttcaccaaatttttagttaatcgccgaggcgaagctatt
gaacgatttgcatcgaccacgaaacccgaagcattagaaagtaaaattgccgctttgcta
aaataa

DBGET integrated database retrieval system