KEGG   Shewanella baltica OS678: Sbal678_1467Help
Entry
Sbal678_1467      CDS       T01725                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbt  Shewanella baltica OS678
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbt00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sbt00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1717173..1719920)
Genome map
AA seq 915 aa AA seqDB search
MKGLIKGKGKIKWQGIKTALISGVMAVLPAMPVLSILAMPSLQAANAVQEANHVALNQLA
DKLQLNYQLTASYLETCPAKETQCYHSAIELTLPTQLSNDKLSSEELNHGDWQIYFSQLS
PVYFVDAGDFNIEHINGDLHKITPKASFKGFVANQVYRIEFYSKGSQITRSEFMPNFFVA
MGDKAQVIKSTQTRRDPETGLAEQDYLAPFNAEKQFLLAKNDATPFADGQYLAEQYQALA
ANANKATDISDKLIPTPLHSQSLDSAPLSLAKGYRLTADAVDFKGRQAAFDYLASLGFAA
KDKGTPLLLQLDTQAPKVASTEAHDSEMKTSEAYQLTITAEQISIRAGTEAGLFYGLQSL
AGLISLSDDQLVAIEIQDQPRYAFRGLHIDLARNFHSLDFIKRIIPQLAAYKINKLHLHL
ADDEGWRLAIPGLPELTDVGAKRCFDLTEQTCLLPQLGSGIADVKPVDGYLTVAQYQEIL
QLADAHHIEMIPSLDMPGHSRAAIKSMEARYHHYLAKGDKAKAEEFLLTEFADKTQYSSI
QYYHDNTLNVCLASTYHFIDTVIDEVKKMHQAVGVPLVHYHIGADETAGAWVDSPACIAM
KQQKADELTGLHSLNGYFIERVANMLADKGIIAAGWNDGMGEVRPENMPAQVQSNAWSLI
SDNGHQIAHKQANLGWKVVISTPEVTYFDFPYASHPDERGNHWASRGIDSFKVFSFMPDN
LPAHAERWRNTLNQPFTSDDTQSQLHAGRVFYGLQGHLWSEMVQSDEQAEYMLFPRMVAL
AERAWHRAPWELAYDYQGKIYSQQTQHFASQLNGQAEQVLKQDWQTFAAVYANKVQPKLA
KAGIFYRIAPPGIRVEHQQLVLNSLYPNAELEYQLDSGPWLSYRQAFKLNDVKHIRARVK
DGTRYSRPSTWQSSL
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggactaattaaaggaaaagggaagataaagtggcaggggattaagacggcctta
atcagcggcgtcatggccgtgcttcccgcgatgccagtgctttcaatacttgcgatgcca
tcgttacaggcagccaacgccgtgcaggaggcaaatcatgtcgcacttaatcaattggcc
gataaactccaattaaattatcagttaaccgccagttatcttgaaacctgtcccgctaaa
gaaacccagtgctatcactccgccattgagctgaccttgcccactcagttatctaacgac
aagttatccagcgaagagttaaatcacggcgactggcaaatttatttcagccagctatcg
cccgtttattttgtcgatgcgggtgactttaacattgagcatatcaatggcgatttacat
aaaatcacgcctaaagccagttttaagggtttcgtcgccaatcaagtttatcgtattgag
ttttatagcaaaggcagccaaatcacccgttccgagtttatgccaaacttctttgtcgct
atgggcgataaggcgcaggtcataaagagcactcaaacaaggcgcgatccagaaacgggt
ttagccgagcaagactacctcgcgccttttaatgccgagaaacaattcttactggcaaaa
aacgatgcaaccccctttgccgatggtcagtatttagccgagcaatatcaagccttagcc
gcaaacgcaaacaaggcaactgacattagcgacaaactcatccccacgccacttcacagc
caaagcctagactcagcgcccttatctcttgccaaaggttatcgactcacggctgatgcg
gtagactttaaaggacggcaggcggcgtttgattacctcgccagtttagggtttgcagcc
aaggacaaaggcacgccgctgttattgcaactcgatactcaagcccctaaagtcgccagc
actgaagcccatgatagtgaaatgaaaaccagcgaagcctatcagttaaccataacggct
gagcaaatcagtattcgagcgggcactgaagcgggactcttctatggcctacaaagccta
gcagggttgatcagtttaagtgacgatcaactggtcgccatcgagatccaagaccagcct
cgctacgcctttcgcggcctgcacatcgatttagcccgtaacttccactcgctagatttt
attaaacgcatcattccacagctcgccgcctataaaatcaataagctgcatttgcactta
gccgacgacgaaggctggcgtttagccatacccggcttacccgaactgaccgatgtgggc
gcaaaacgctgtttcgatttaaccgagcaaacctgtttattgccacaactaggcagcgga
attgcggacgttaagcccgtcgatggctacttaaccgtggcacaataccaagaaatatta
caactggctgatgctcaccatatcgaaatgatcccctcactggacatgccagggcattcc
cgcgccgcgataaaatccatggaggcgcgttatcaccattacctagcaaaaggagataaa
gctaaggcggaggagtttttactgactgaatttgcagataaaacccaatattcgtcgatt
cagtattatcacgacaatacactcaatgtgtgcttggcgagcacctaccactttatcgat
actgtgattgatgaagtcaaaaaaatgcaccaagccgtaggcgttcccttagtgcattac
cacataggtgccgatgaaaccgcgggcgcttgggtcgactctcccgcgtgtatcgcaatg
aagcaacaaaaagccgatgagttaaccggactgcattcgctcaatggttactttatcgaa
cgcgttgctaacatgctggcagataaagggattattgccgcaggttggaatgatggcatg
ggtgaagtgcgccccgaaaacatgcccgcccaagtgcaatctaacgcttggtcactgatt
tcggataacggtcatcaaatcgcccataagcaagccaatttaggctggaaggtggtgatt
tcaacgccggaagtcacctattttgatttcccctatgctagccatccagatgagcgcggc
aatcattgggcctcgagggggattgacagttttaaggtgtttagctttatgccagacaac
ctgcccgcccacgccgagcgctggcgcaacacgcttaatcaaccctttacctcagatgat
actcaaagccaattgcatgctggccgcgttttttatggcttacaggggcatctttggagc
gaaatggtgcaatcggacgagcaagcagaatacatgttattcccgcgcatggtcgccctt
gcagaacgggcatggcatagggcgccatgggaattagcctatgattatcaaggtaaaatc
tatagtcagcaaactcaacattttgccagccaactcaatggccaagccgagcaagtcctc
aaacaggattggcaaaccttcgccgcggtttacgccaataaagtgcaacctaaattagca
aaagcggggattttctaccgcatagcaccgcctggaatacgtgttgaacatcagcagtta
gtgctcaatagcttatatcccaatgccgagctggaatatcaactcgactcaggaccttgg
ctaagctaccgccaagcgttcaagcttaatgatgtcaaacacatccgcgccagagtcaaa
gatggtacgcgttactctcgcccatcgacttggcaaagctccctctaa

DBGET integrated database retrieval system