KEGG   Shewanella baltica OS678: Sbal678_1468Help
Entry
Sbal678_1468      CDS       T01725                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbt  Shewanella baltica OS678
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal678_1468
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal678_1468
   00052 Galactose metabolism
    Sbal678_1468
   00500 Starch and sucrose metabolism
    Sbal678_1468
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal678_1468
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sbal678_1468
   00524 Butirosin and neomycin biosynthesis
    Sbal678_1468
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sbal678_1468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1719917..1720759)
Genome map
AA seq 280 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLFDFLVTCIHSHLTPETYGIS
IGIPGMVDMQSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNRNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
HLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLVYDPKDIILGGSVSQSFPFFIEALNQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQKDSVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgatggcaatttcgaacagtta
ttcgatttcctcgtgacctgtatccacagccatctcacgcctgaaacctatggtatttcc
atcgggatacccggcatggtggatatgcaaagcggcactttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtg
gttgtgaataacgacgctaacctctttgcccttggcgaagctgtgctcaatcgcaatcaa
gacatgctcgggattaccttaggcacaggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggtgaaatcggcagtttgagttatcgcgatggc
ataattgagcactattgctcggggcaatacttcaccactcatcaccacatgagtggcgag
catttgtaccaaaaagcctgtgaaggagacagccaagcgctacaagccttcgcccatttt
ggtgaacacttggcgcacatgatcgcccaaaccttactggtatacgatcccaaagatatc
atccttggcggctcagtcagccaaagctttcccttctttattgaagcgcttaatcagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcattggcgcggcacaatggtttttacaacaaaaggactcagttaag
tga

DBGET integrated database retrieval system