KEGG   Shewanella baltica OS678: Sbal678_1523Help
Entry
Sbal678_1523      CDS       T01725                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sbt  Shewanella baltica OS678
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sbt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1789062..1790252
Genome map
AA seq 396 aa AA seqDB search
MQNMVILGATGSIGASTLSVISANPFAYSVYGLVANASVDKMLALCVAHKPKVAHMVDEA
AAKQLRAVLPATLNIQVTTGMNDLLGLVTAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVL
LANKEALVMSGELFIEATKRSGAVLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHI
LLTGSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNT
QAEQLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFK
VGQLSFYEPDFERFPCLALAMEACAQGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNE
ACLVTVPKRPMGSIEDILALDAQTRVYARETLASIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatggtgattttgggtgctaccggctctataggtgccagtaccttaagtgtg
atctcggctaatccatttgcttatagcgtgtatggattagtggccaacgcgagcgttgat
aagatgcttgcactctgtgtggcccataaaccgaaagtggcgcatatggtggatgaagcg
gcagcaaaacagttgcgtgccgttttacctgcgacgctcaatatccaagtcaccactggc
atgaacgatttactcggtttagtgaccgctgccgaagtggatactgtgatggcggcgatt
gtaggggctgcagggctagtaccgacgcttgaagccgtaaaggcgggtaagcgggtatta
ctggccaacaaagaagccttagtcatgtcaggtgagctgtttattgaggcgactaagcgc
tctggcgcagtgctcttgcctgtggacagtgagcataatgccatcttccaatgtcttccc
caggaagtgcaagccaatcttggccgttgtgacttagcggcatcgggtatttcccatatt
ctgttaaccggttctggcggacctttcctgcggtcggatttggcgacactggccgccatg
acgcctgcccaagcctgtaaacatcctaattggtccatgggacctaaaatctccgtcgac
tccgccactatgatgaataagggcttagagtttattgaggcgcgttggttgtttaacact
caggctgagcaactgaaggtggttatccatccgcaaagcgtgatccactcaatggtgcag
taccgtgatggctccgttattgcccaaatgggtaacccagatatgcgtacgcctattgcc
cattgcatggcttatccgcaaagaattcattctggcgttgaacctttagattttttcaaa
gtcggacagttaagcttttatgaacctgattttgaacgtttcccctgcttggctttggca
atggaagcctgtgcccaaggccaagaggcgacaactgtgttaaatgctgccaatgagatt
gccgttgaagcatttttacaggggcaaattggctttacgcaaattgcaaaagtgaacgaa
gcttgtttagtgactgtgcctaagcgccctatgggcagcatagaagatattttagcctta
gatgcgcaaacccgcgtctatgcgcgtgagaccttagcaagcatcgcttag

DBGET integrated database retrieval system