KEGG   Shewanella baltica OS678: Sbal678_1804Help
Entry
Sbal678_1804      CDS       T01725                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbt  Shewanella baltica OS678
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal678_1804
Enzymes [BR:sbt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sbal678_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113212..2114060)
Genome map
AA seq 282 aa AA seqDB search
MGSVTTKKHANGLDYVEVNTALCQARIFLQGAQIDYFQPVGKPPLLWVSSADDYQPGNGI
RGGVPVCWPWFGMSSEANFPQHGFARTRIWALESVEMRNQLVDLRFSLKISEQDKIYWPH
NTQVSVLFTLGDTLSISLVNTNLGDETVTLTQALHTYFPIEDIQQLKASGFSGSKYIEFA
EGPYPQTTDEVRFDRETDRVYTELGPVQLLHTPQGIIEVSRENSLSAVLWNPWIEKSQRL
DRFNPEDYLTMVCLEAANVLEDKVVLAQSETHSLVTHICWKD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgtcactactaaaaagcacgccaacgggctcgattatgtcgaagtgaatacg
gcgttatgtcaggcaagaatttttttgcagggcgcgcaaatagactattttcaacccgta
ggaaaaccacctttgctgtgggtttcatcggctgacgattatcaacccggtaatgggatc
cgtggcggagtgcccgtatgctggccttggtttggcatgagtagtgaagcaaacttcccc
caacacggttttgcccgcacccgcatttgggcgctggaatcggtagaaatgcgtaatcag
ttagtggatttacgttttagcttaaagatcagtgagcaagataaaatctattggccgcat
aacactcaggtcagcgtgttattcaccctaggcgacaccctgagtatcagtcttgtgaat
accaacttaggcgatgaaaccgtgacgcttacccaagcgctgcacacttatttcccgatt
gaggatatccagcaactcaaagcgagcggttttagtggctcaaaatacatcgaatttgcc
gagggaccttatccgcaaaccacggatgaagtgcgctttgatcgcgagacagatcgtgtc
tataccgaactcggccctgtgcaattattgcatacgccgcaggggataattgaagtcagc
cgcgagaacagcctatcagcggtattatggaatccatggattgaaaagtcacaacgcctt
gaccgctttaatccagaggattatttgaccatggtctgtctagaagcggccaatgtttta
gaagataaagttgtgcttgcccaaagtgaaacccacagtttagtgacccatatttgctgg
aaagactaa

DBGET integrated database retrieval system