KEGG   Shewanella baltica OS678: Sbal678_1808Help
Entry
Sbal678_1808      CDS       T01725                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbt  Shewanella baltica OS678
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal678_1808
Enzymes [BR:sbt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Sbal678_1808
Peptidases [BR:sbt01002]
 Cysteine Peptidases
  Family C44
   Sbal678_1808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2120273..2121937)
Genome map
AA seq 554 aa AA seqDB search
MCSIFSILDIQSDAKELRQVALEMSKLMRHRGPDWSGIYASDKAILAHERLAIVDIEHGA
QPLLTEDGSLILAVNGEIYNHKELKAQLGDKYSYQTNSDCEVILALYQEYGTDFLDKLNG
IFAFVLYDKAQDRYLIGRDHMGIIPLYTGRDAAGNFYVASEMKALMPVCKTVEEFLPGQY
LYSKDGEAVKYYSRDWQSYDAVKDNPASQEELRDALEAAVKRQLMSDVPYGVLLSGGLDS
SIISAVTQTFAKRRIEDDGETNAWWPQLHSFAVGLEGAPDLIAAKKVADAIGTIHHEIHF
TFQEGLDAIKEVIYHLETYDVTTIRAATPMYLMARKIKAMGIKMVLSGEGADELFGGYLY
FHKAPNAQAFHEELVRKLDKLHLFDCLRANKAMAAWGLEARVPFLDKEFMDVAMRINPEA
KMSKDGRIEKHILRQAFEHKLPKEVAWRQKEQFSDGVGYSWIDGLKEQAAARVDDLQLAN
AKFRFPYNTPETKEAYFYRCFFEEHYPLSGAAETVPGGKSVACSTPEALAWDESLRGIID
PSGRAVRSVHTSSY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatcttttcgattttagatatccaatctgatgccaaagaactgcgccaagtc
gcgctagaaatgtctaagctaatgcgccaccgtggccctgactggtcaggtatttatgcc
agtgataaggcaattcttgcccacgaacgtttagcgattgttgacattgaacacggtgct
cagccgctactgaccgaagatggcagtttgatccttgcggtcaacggcgaaatctataac
cacaaagaattgaaagcccagctaggcgataagtacagctatcaaaccaactctgactgc
gaagtcattctggcgctgtatcaagaatatggcactgacttccttgataaattaaacggt
atcttcgcctttgtgttatatgacaaagcccaagatagataccttatcggccgcgatcac
atgggtatcatcccgctatacacaggccgtgacgctgcgggtaacttctatgttgcctct
gaaatgaaagcgctgatgccagtgtgtaaaaccgtagaagagttcttaccgggccagtat
ctgtattcaaaagatggtgaagccgttaaatactatagccgcgattggcaaagctatgat
gcggttaaagataacccagccagccaagaagaattacgtgacgcattagaagcagcggtc
aaacgccaattaatgtcagacgtgccctatggtgtgttgctatcaggtggcttagattca
tcgatcatttccgccgtgacgcaaacctttgctaaacgccgcattgaagacgatggcgaa
accaacgcttggtggccacagttgcattcttttgctgtcggccttgaaggtgcgccagat
ttaatcgccgccaaaaaagtcgctgatgccattggtacgattcaccatgagatacatttc
accttccaagaaggcttagatgcgattaaagaagtgatttatcacttagaaacctacgat
gtcaccaccatacgtgccgcgacacctatgtatttaatggcgcgtaaaatcaaagccatg
ggcattaagatggtgttatcgggagaaggtgctgatgagctatttggcggctatttatac
ttccataaagcgccaaacgcacaggcattccacgaggaattagtccgcaaactcgataag
ctgcatctgttcgattgtctgcgtgccaacaaagccatggccgcttggggattagaagcc
cgcgtgcccttcctcgataaagagtttatggatgtggcgatgcgcatcaaccctgaagcg
aaaatgtctaaagatggtcgtatcgagaaacacattctgcgccaagcctttgagcataaa
ttgccaaaagaagtggcgtggcgtcaaaaggaacaattcagtgacggcgtcggctactct
tggattgacggtttgaaagaacaagctgcagcgcgggtggatgatttacaattggcaaac
gcgaaattccgtttcccatacaacaccccagagaccaaagaagcctatttctatcgctgc
ttctttgaggaacattatccattgagcggcgccgctgaaacggttccaggtggtaaatcc
gtcgcctgttcaacgccagaagcgctggcttgggacgaaagcttacgcggcattatcgac
ccatcgggccgagcagtacgctcagtgcacacctcaagttattaa

DBGET integrated database retrieval system