KEGG   Shewanella baltica OS678: Sbal678_1918Help
Entry
Sbal678_1918      CDS       T01725                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbt  Shewanella baltica OS678
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2247970..2248995)
Genome map
AA seq 341 aa AA seqDB search
MSLELLQAAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNPELNQRLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDANEFQSRIESNFEKL
NRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCFNRRAFDSDFAGMLAQAPLGTCVILADIDHFKVFNDTYGHQLGDQVLRAVAKR
LQESCRDGAKLYRFGGEEFVIIVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERINNIS
ASFGVAQWQEKQTGMQLIEAADKLLYDAKRLGRNRVLPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagagttattacaagccgctgcactgaatctcaaaaaagcagtgcctctgatg
ctcaaacataaaattccgaccaccccggttaactatgcgctttggtacacttatgttggt
gaacagaatcccgaattaaatcaacgactcgataccgttatcgcccagtacaacacttgt
cctcctgtgagtagcgaactcttatatcgccagtatgttgccgatcccgttgaactcgat
gtccgcgaaatgcgccagaatctggatgctatggtgactgagctgtcccaatcgctcaaa
gataccaatctagatgccaatgaattccagtcgcgcatcgagagtaattttgaaaagctc
aaccgcatcgaagatgagggttttagtgttgagcaagtgctcgatctggtgcgcagttta
gtgaaagagtcggacaatattcgctcgagcactgagttctttaccggacaattgcagaaa
gcgcaaaccgaaatcgatgcgctaaagaaaaagctcgaacagacagaaaaagatgtgctc
tacgatgcgctgactggctgctttaatcgccgcgccttcgacagcgattttgctggcatg
ttagcccaagcgcccttaggcacctgcgtgatcttggccgatatcgaccattttaaagtg
tttaacgacacctacggccaccagctcggcgaccaagtgttacgcgccgtggcaaaacgg
ctacaggaatcctgccgcgatggcgcaaaactgtatcgttttggcggtgaagaatttgtg
attattgtgcctaaaagtcagttacgcatcgcaaggcaactggccgaagccatgcgccgt
ggactcgaaaagctcagtttgaaagacagacgtaaagacgagcgcatcaataatatcagt
gcctcatttggggttgcccaatggcaagaaaaacaaacgggcatgcagttgattgaagcg
gcagataaattactctatgacgcgaaacgtttaggtcgaaatcgcgtgttgccgatcagc
aactga

DBGET integrated database retrieval system