KEGG   Shewanella baltica OS678: Sbal678_1961Help
Entry
Sbal678_1961      CDS       T01725                                 

Definition
hydrogenase (NiFe) small subunit HydA (EC:1.12.5.1)
Orthology
K05927  
quinone-reactive Ni/Fe-hydrogenase small subunit [EC:1.12.5.1]
Organism
sbt  Shewanella baltica OS678
Brite
Enzymes [BR:sbt01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.5  With a quinone or similar compound as acceptor
    1.12.5.1  hydrogen:quinone oxidoreductase
     Sbal678_1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2294004..2295140)
Genome map
AA seq 378 aa AA seqDB search
MDTHAALYEQGKARLDALRQFAPRQQQSLIEKMQQHGISRRDFMKWSAMVTSMLALPLPF
SNLVAEAAELADRVPLIWLHMAECTGCSESLIRTDTPNLDSLIFDHISLEYHETLMAAAG
WQAEENLENALETYKGRYLLAVEGAIPTANNGSFLTVGCKGHTGLEIIKHAAEGAAAIIS
VGTCAAFGGVQAAYPNPTGAKGVHEVVSKPVINLGGCPPSEKNIVGTLMYFIMFGKLPAL
DMFNRPKWAYGARVHDNCERRGRFDAGEFVEEFGDHGAKEGYCLYKVGCKGPYTYNNCPT
ERFNHHTSWPVLAGHGCMGCSEPNFWDDMADFEKPLGRQLLHGLDATADTIGAVILGATV
VGIGAHAVASIFAKPLEE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacacacatgcagccctatatgaacagggaaaggcgcgcttagatgcgttacgccaa
ttcgctccccgtcaacaacaatcgctgattgagaaaatgcaacagcacggcattagccgc
cgtgattttatgaagtggagtgccatggtgacgagcatgctcgcattgccgctccccttt
agtaacttagtagccgaagctgccgaattagccgaccgtgtacccttaatctggttacac
atggccgaatgtactggctgctcagaatccttaattcgtactgatacccccaatctagat
tcgctgatttttgaccatatctccttggaatatcacgaaaccttaatggctgctgcgggt
tggcaagccgaagagaacctcgaaaatgcactcgaaacctacaagggccgctatttactg
gccgttgaaggggcgattccaaccgccaataacggcagcttcctcactgtgggctgtaaa
ggccacacaggattagaaatcatcaagcatgctgcagaaggcgccgccgcgattatctct
gtcggcacttgtgcggcgtttggtggtgtgcaagccgcctatccaaacccaacgggggcg
aaaggcgtgcacgaagtggtcagtaaacccgtcattaacttaggcggttgcccaccgagc
gaaaagaacatagtcggcactttgatgtacttcatcatgttcggcaaattacctgcgctg
gatatgtttaacagaccaaaatgggcttacggcgcacgggtacacgataactgtgaacgt
cgcggccgctttgatgccggtgaattcgttgaagaatttggcgatcacggcgcgaaagaa
ggctactgcctgtataaagtcggttgtaaaggtccttacacctacaacaactgccctacc
gagcgctttaaccatcacaccagctggccagtacttgctggacacggttgtatgggctgc
tcagaacctaacttctgggatgacatggccgactttgaaaaaccccttggccgtcaactc
ctccatggattggatgcgaccgcagatactattggtgcggtgattttaggcgcgactgtt
gtgggcattggagcccatgccgttgccagtatttttgccaaaccgctggaggaataa

DBGET integrated database retrieval system