KEGG   Shewanella baltica OS678: Sbal678_2525Help
Entry
Sbal678_2525      CDS       T01725                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sbt  Shewanella baltica OS678
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sbt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2930893..2931921)
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSLDVSEAESEMLRHPQVGGLILFSRNFSSRDQLIRLVQQIRQIRPELLIAV
DHEGGRVQRFRDGFTVIPAMGDILPAAKGDIALAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGVSQVIGKRSFSPEPAEVITLAESFIAGMAAAGMGAVGKHFPGHGSVVADSHYEK
PIDERDAEAIFAKDILPFKELIAKEKLLGVMPAHVVYPKVDPNSAGFSEYWLKQVLRKEL
GFNGVIFSDDLGMQGAGFAGDYRARASAALAAGCDMILVCNDNAGVMSLLDGFTWPASAP
QYPASLLKPNAAQTAAALDNTARWENAKQLAEQICLAQQAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagctatttaatgttggacctactgtcgttggacgtcagtgaggcagaatctgagatg
ctacgccatccacaggtgggtggtttaattctattttcccgcaatttttcaagccgtgat
cagctgatccgtctggtacaacagatacgtcaaatccgccctgaactattaattgccgtc
gatcatgagggcggtcgagtacaacgcttccgcgatggctttaccgttattcccgccatg
ggcgacattttacccgcggcaaaaggtgatatagcgttagccaaacgctgggcctgtgag
ctcggtttcttgatggcgattgaactactggcctgcgatatcgacttaagtttcgcgccc
gtattggacttaaacggcgtgagccaagtgattggtaaacgcagttttagccctgagcct
gccgaggtgattacactggccgaaagctttattgccggcatggccgccgctggcatgggc
gccgtgggtaaacatttccccggacacggcagcgtagtggcggattcgcactacgagaaa
ccgattgatgagcgcgatgccgaggcgatttttgcgaaggatatcctgccgtttaaagaa
ttgatcgcaaaagaaaagttattaggcgtgatgcccgcgcacgtggtttatcctaaagtc
gacccgaactctgcgggtttttctgaatactggctaaaacaagtgctgcgcaaagaactt
ggctttaacggggtgattttctccgacgatctcggcatgcaaggcgcaggatttgcgggc
gattaccgagcaagggccagcgcggcgttagctgccggttgcgacatgattttagtgtgt
aatgacaatgcgggcgtaatgtcgctgctggatggttttacatggccagcgagtgcgccg
cagtatcctgcaagtttactcaagcccaatgccgcacaaacggccgcagcgctcgataat
accgcccgttgggaaaacgcgaaacagcttgcagagcaaatttgtttagcccaacaggcg
aaagtttga

DBGET integrated database retrieval system