KEGG   Shewanella baltica OS678: Sbal678_2525Help
Entry
Sbal678_2525      CDS       T01725                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sbt  Shewanella baltica OS678
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal678_2525
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sbal678_2525
Enzymes [BR:sbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sbal678_2525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2930893..2931921)
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSLDVSEAESEMLRHPQVGGLILFSRNFSSRDQLIRLVQQIRQIRPELLIAV
DHEGGRVQRFRDGFTVIPAMGDILPAAKGDIALAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGVSQVIGKRSFSPEPAEVITLAESFIAGMAAAGMGAVGKHFPGHGSVVADSHYEK
PIDERDAEAIFAKDILPFKELIAKEKLLGVMPAHVVYPKVDPNSAGFSEYWLKQVLRKEL
GFNGVIFSDDLGMQGAGFAGDYRARASAALAAGCDMILVCNDNAGVMSLLDGFTWPASAP
QYPASLLKPNAAQTAAALDNTARWENAKQLAEQICLAQQAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagctatttaatgttggacctactgtcgttggacgtcagtgaggcagaatctgagatg
ctacgccatccacaggtgggtggtttaattctattttcccgcaatttttcaagccgtgat
cagctgatccgtctggtacaacagatacgtcaaatccgccctgaactattaattgccgtc
gatcatgagggcggtcgagtacaacgcttccgcgatggctttaccgttattcccgccatg
ggcgacattttacccgcggcaaaaggtgatatagcgttagccaaacgctgggcctgtgag
ctcggtttcttgatggcgattgaactactggcctgcgatatcgacttaagtttcgcgccc
gtattggacttaaacggcgtgagccaagtgattggtaaacgcagttttagccctgagcct
gccgaggtgattacactggccgaaagctttattgccggcatggccgccgctggcatgggc
gccgtgggtaaacatttccccggacacggcagcgtagtggcggattcgcactacgagaaa
ccgattgatgagcgcgatgccgaggcgatttttgcgaaggatatcctgccgtttaaagaa
ttgatcgcaaaagaaaagttattaggcgtgatgcccgcgcacgtggtttatcctaaagtc
gacccgaactctgcgggtttttctgaatactggctaaaacaagtgctgcgcaaagaactt
ggctttaacggggtgattttctccgacgatctcggcatgcaaggcgcaggatttgcgggc
gattaccgagcaagggccagcgcggcgttagctgccggttgcgacatgattttagtgtgt
aatgacaatgcgggcgtaatgtcgctgctggatggttttacatggccagcgagtgcgccg
cagtatcctgcaagtttactcaagcccaatgccgcacaaacggccgcagcgctcgataat
accgcccgttgggaaaacgcgaaacagcttgcagagcaaatttgtttagcccaacaggcg
aaagtttga

DBGET integrated database retrieval system