KEGG   Shewanella baltica OS678: Sbal678_2629Help
Entry
Sbal678_2629      CDS       T01725                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00020  Citrate cycle (TCA cycle)
sbt00640  Propanoate metabolism
sbt00660  C5-Branched dibasic acid metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt01130  Biosynthesis of antibiotics
sbt01200  Carbon metabolism
Module
sbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal678_2629
   00640 Propanoate metabolism
    Sbal678_2629
   00660 C5-Branched dibasic acid metabolism
    Sbal678_2629
Enzymes [BR:sbt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sbal678_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADT94780
JGI: Sbal678_2629
Position
complement(3059304..3060470)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGHIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHTAIIDPLTGPQGYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALYRQPKIKGMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccttatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagctgcaggccatattggcgga
aatttatgggttgttaagtgtcaagtacacgctggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaactgatgagaaaggtcagccagtagctaaaattttagtagaaagc
tgcaccgacatcgctaacgaactgtacctaggtgccgttgttgaccgcgcgactcgtcgc
gttgtgttcatggcgtcgactgaaggtggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcatccacactgcaatcatcgatcctttgactggtccacaaggttatcaagca
cgtgatcttggcttcaagttaggtttaaacccaactcaaatgaagcagttcactaagatt
ttcatgggtctggcgactatgttcgttgatcatgatttcgcattgcttgaaatcaacccg
ctggttattaccactgaaggcaacctacactgcctagacggtaaaatcggtatcgacggt
aacgcactttatcgtcaaccaaaaatcaaaggcatgcacgatccatcacaggatgatgcc
cgcgaagctcacgctgctaagttcgaactgaactatgtagcattagacggtaacgttggc
tgtatggtcaacggtgcaggtctggctatgggtactatggatatcgttaacttgcacggt
ggcaagccagcgaacttcctagacgtaggcggcggcgcgactaaagaacgtgtagcagaa
gcattcaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacattttcggc
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggcgcggttaaagaagtgggc
gttaaagtaccagttgtggttcgtttagaaggtactaacgctgaacttggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaccagtctgactgacgcggctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system