KEGG   Shewanella baltica OS678: Sbal678_2630Help
Entry
Sbal678_2630      CDS       T01725                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbt  Shewanella baltica OS678
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal678_2630
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal678_2630
  Amino acid metabolism
   00310 Lysine degradation
    Sbal678_2630
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sbal678_2630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3060576..3061766)
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSDESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAAPAVAPLAAGRSEKRVPMTRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDG
KLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcaccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatctggcaaagaagtcactaaagcgcaagctgaagcggctacgcctgcagctgaaacc
agcgatgaaagcagtgatgcgttaagcccatctgtacgccgtttactggctgagcacaat
gttgatgccagcaaagtaaaaggcacaggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagcagcggcgccagcagcacctgctgtggctcca
ttagcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgct
aaccgcttgttagaagcgaaaaactctaccgctatgctcaccacgtttaacgaagtgaac
atgaagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggt
atccgtttaggctttatgtctttctacattaaagccgtgactgaagcgctgaaacgtttc
cctgaagtgaacgcgtctattgatggcgatgatatcgtttatcacaactacttcgacatc
agcattgctgtatcaacgccacgtggtctggtaacaccagtattacgtgacactgatacc
atgaacttagctgaaatcgaaaaagctgtccgtgacttagcccttaaaggccgtgacggt
aagctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggtgttttc
ggttcactgatgtctacaccgattcttaacctgccacaaagcgcgattttaggcatgcat
gccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtac
ctggcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtg
gcgattaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system