KEGG   Shewanella baltica OS678: Sbal678_2634Help
Entry
Sbal678_2634      CDS       T01725                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00020  Citrate cycle (TCA cycle)
sbt00190  Oxidative phosphorylation
sbt00650  Butanoate metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt01130  Biosynthesis of antibiotics
sbt01200  Carbon metabolism
Module
sbt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal678_2634
   00650 Butanoate metabolism
    Sbal678_2634
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal678_2634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADT94785
JGI: Sbal678_2634
Position
complement(3067330..3067677)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtctggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtagcattattagtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system