KEGG   Shewanella baltica OS678: Sbal678_2651Help
Entry
Sbal678_2651      CDS       T01725                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbt  Shewanella baltica OS678
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3087654..3088688
Genome map
AA seq 344 aa AA seqDB search
MTKLTSIAIFIAGIFASAHAISAEPIEVIKAVKVTEPEKVELGKMLFFEPRLSKSGYISC
NSCHNLATGGVDALPTSVGHNWQQGPINSPTVLNANYMLAQFWDGRASDLQAQAAGPIEN
PKEMGYSHALATQTIASMPAYRAHFAKVYGDENVTIDRLTDAISTFEKTLVTPNSPFDQY
LLGKQDAISVDAKAGYQLFKSKGCVSCHNGPAVGGTMYMKMGLIKPFHTNNPAEGRIAVT
GKEADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKENLEMVAFL
VSLTGDQPQITLPILPPSNKNTPRPVPFSHDPMSSKPVSSEPLK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcacatctattgctattttcattgcgggtattttcgccagtgcccatgcc
atcagtgctgaacccatcgaagtgataaaagcggtgaaagttaccgaaccggagaaagtt
gaactcggtaaaatgctgttcttcgaaccaaggctatccaaatcgggctacatctcctgt
aactcttgccacaatttagccactggcggagtcgatgcactaccaacctctgttggccat
aattggcaacaaggcccgattaactcgcccacagtgctcaatgccaattatatgctggcg
caattttgggatggccgcgccagtgatttacaagcgcaagccgctggccctatcgagaat
cctaaggaaatgggctatagccatgcactcgcgacacaaactattgcctctatgcctgcc
tatcgggcgcattttgccaaagtctatggcgatgaaaacgtcacgattgatcgcttaacc
gatgcaatttccacctttgaaaaaaccttagtcacgccaaatagtccgttcgatcaatat
ttattgggtaagcaagatgcgatcagtgtggatgccaaagcgggttaccaactgtttaag
agcaaagggtgcgtaagctgccataacggtccagccgtcggtggcactatgtatatgaag
atgggattgattaaacctttccacactaataatcccgccgaaggtcgtatcgccgtcaca
ggtaaagaagccgataagtttgtctttaaagtgccgacactgcgcaatattgaactcacc
tatccctacttccacgacggcagtgtctggaccttagaagaagcggtgaacactatggcc
gatattcaattaggccaaaaactgtcggacaaagaaaatctagaaatggtcgcctttctc
gtctcgttgacgggagatcaacctcagatcaccttgccgattttgccgccatccaacaag
aacacaccgcgcccagtgccttttagccatgatccaatgagtagcaagccagttagcagt
gagccattaaagtag

DBGET integrated database retrieval system