KEGG   Shewanella baltica OS678: Sbal678_2692Help
Entry
Sbal678_2692      CDS       T01725                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sbt  Shewanella baltica OS678
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal678_2692
DNA repair and recombination proteins [BR:sbt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sbal678_2692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3143060..3143659)
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDVGHCQSC
RTYTEETLCPICASHKRGTSSTICVVETPADVLAIEAGGHFTGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVAELILATNPTVEGEATAHFIADMARRHKVMISRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtccactgttagatgagttaattcagtccctgcgttgtttacctggggtt
gggcctaaatcggcgcaacgtatggcgtttcagttactcgagcgcgacagaaaagcaggg
cttaaattagccagtgcgctgtccagtgcgatgagtgacgtcggtcattgtcagtcttgc
cgaacctacactgaagaaaccctctgtccgatttgtgctagccataaacgcggcacgtct
tccaccatttgtgtggtggaaacgccggccgatgtgttagccattgaggcgggtggacat
ttcaccggtcgctactttgttcttttaggtcatttatcgccactcgatggtgttgggcca
gaagagttaggtttagcgttacttgagcgccacttggcctcgggtgatgtggccgagttg
attctggcgaccaatccgacggtagaaggcgaggcaacagcgcattttattgctgatatg
gccagacgccataaggtgatgatcagtcgcatcgcccacggcgtgcccgttggtggcgag
cttgaatatgtggatagcacgacgttagccttgtcattcaatggccgtttaccgctttaa

DBGET integrated database retrieval system