KEGG   Shewanella baltica OS678: Sbal678_2790Help
Entry
Sbal678_2790      CDS       T01725                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sbt  Shewanella baltica OS678
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sbal678_2790
Enzymes [BR:sbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal678_2790
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sbal678_2790
Lipid biosynthesis proteins [BR:sbt01004]
 Fatty acid synthase
  Component type
   Sbal678_2790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3266579..3267148
Genome map
AA seq 189 aa AA seqDB search
MSVFMATPAHAAKVLILGDSLGASYGMAEQSGWVALLQKNLPEHQFTNGSVSGETTAGGL
RRLPALLDSVAPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAKDSGAKVLLTEIMVPP
NYGPRYTQKFTQVYQDISKAQDIVLIPFFMQDIAPHPELMQRDGIHPNEKAQTQIATWMQ
PWIEDALTQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtattcatggccacgccagcgcacgcggcaaaggtgttgatcctcggcgacagc
ttaggcgctagctatggcatggcagagcagtcaggctgggtggcgctgctgcaaaaaaat
ctgcccgaacatcaatttactaatggctcagtgagcggcgaaaccacagctggcggctta
cgccgattacccgccttactcgattccgtcgcccccgaccttgtggtcgttgaactgggt
ggtaatgatggtttacgtggattccccccaacgcaacttgaaaataatctaatccaaatc
attaccctagccaaagatagcggcgcaaaagtgctgctgaccgagatcatggtaccgcct
aactatggccctcgctacacccaaaagttcacccaagtgtatcaagacatatccaaagca
caggatatcgtgttgatccccttctttatgcaggatatcgcgccccatccagaattaatg
caacgggatggcattcaccccaacgaaaaggcgcagacgcagatagcaacttggatgcaa
ccatggatagaagatgcgttaacccaataa

DBGET integrated database retrieval system