KEGG   Shewanella baltica OS678: Sbal678_2812Help
Entry
Sbal678_2812      CDS       T01725                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbt  Shewanella baltica OS678
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal678_2812
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal678_2812
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal678_2812
Enzymes [BR:sbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal678_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
3288833..3290023
Genome map
AA seq 396 aa AA seqDB search
MSKLKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQEDDDFKAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDREGQIEESYS
ISAGLDFPSVGPQHAHLNATGRARYESATDDEALEAFQQLARCEGIIPALESAHAIAYAV
KMARECTKETILVVNLSGRGDKDIFTVSDILNGKEE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttaaagcttaacccttatttcggcgaatacggcggcatgtatgtgccacag
attttagtgccagcccttaagcaattagaaactgcctttgtggaagcgcaggaagatgac
gactttaaagctgaatttaccgatttactgaaaaactacgcgggtcgccctacagcactg
accttaacccgcaatttaagccccaatcctatggtaaaaatctacctcaaacgagaagat
ttactccacggcggcgcacataaaactaaccaagtgttaggccaagctctgctggctaaa
cgcatgggcaaaaaggaaatcattgctgaaactggcgcaggacaacacggcgttgccacc
gcccttgcctgcgcgctattaggcttaaaatgtaaagtctatatgggtgctaaagacgtt
gcgcgccaatcaccgaacgtatttagaatgcggttgatgggcgcggaagtgattccagtc
acctcaggttctgccaccttaaaagatgcctgtaacgaagcgatgcgcgactggtctggc
agctacgaaaaagcccactatttactcggcacggccgcggggccacatccgttcccaaca
atcgtgcgtgaattccaacgtatcattggcgaagaaaccaagaagcaaatgctggaacgc
gaaggtcgcctgcccgatgcggttatcgcctgtgtgggcggcggttccaacgccatcggc
atgtttgctgactttatcgacgagccaagtgtcgaactgattggcgtcgaacctgcgggt
aaaggcatagacacgccaatgcacggcgcgccgcttaaacacggtaagacaggtattttc
ttcggtatgaaagcgcctttgatgcaagatcgcgaaggtcaaatcgaagaatcctactcg
atttcagctggattggacttcccatccgtcggcccgcagcacgcacatcttaatgccaca
ggccgcgcccgttatgaatcagccaccgacgatgaagccttggaagccttccaacaattg
gctcgctgtgaagggattatccctgcattggaatcggcacatgctatcgcctatgcagtg
aaaatggcacgcgagtgcaccaaggaaaccattttagtggtcaatctttccggtcgtggc
gacaaagatattttcaccgtttctgacattttgaatggtaaagaggaataa

DBGET integrated database retrieval system