KEGG   Shewanella baltica OS678: Sbal678_2813Help
Entry
Sbal678_2813      CDS       T01725                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbt  Shewanella baltica OS678
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal678_2813
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal678_2813
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal678_2813
Enzymes [BR:sbt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal678_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3290029..3290850
Genome map
AA seq 273 aa AA seqDB search
MSDTSTNTGRYQATFAKLKTEGRGAFVPFVTLGDPSPVLSLKIIDTLVQNGADALELGFP
FSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFANGIDA
FYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLALVSASGEGY
TYLLSRAGVTGTDTKAGVPVEEILSKLKTFNAPPPLLGFGIAEPAQVTAAIKAGAAGAIS
GSAVVKIIETHQHDEAKLLAALGDFTRAMKAAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacacgtctaccaacactggccgttaccaagccacctttgccaaactcaaaact
gaaggtcgtggcgcttttgtcccattcgtcacccttggcgatcctagccctgtgttatcg
ctgaaaattatcgataccttagtgcaaaacggtgccgatgccttagaactgggctttccg
ttttccgatcccttggccgatggccctgtgatccaaggtgctaacctgcgttctttagcg
gcgggcacgactccaacggcgtgttttgaattactggcgcaagtgcgtgctaaatatcct
gaactgccaatcggtttgctgctgtatgcgaacttagtttttgctaatggcatagatgcg
ttttacgccaaagcgcagcaagcgggtgtggattcagtgcttattgccgacgtacccgta
gaagaatcggcgccctttagcgaagccgctaaagcccatggtatcgcacccatttttatc
gcgccgcccaatgccgacagtgaaacccttgcactggttagcgccagcggcgaaggttac
acctatctcttatcccgcgcaggggtgacaggcacagacactaaagctggcgttccggtg
gaagaaattctatccaaattgaaaacttttaatgcgccgccaccgctactcggctttggt
attgccgaaccggctcaagtaaccgccgctatcaaagcgggcgctgctggggcgatttca
ggctctgccgttgtaaaaattatcgaaacccaccagcacgatgaagctaaactacttgcg
gcgcttggggattttactcgcgccatgaaagcggcgacctaa

DBGET integrated database retrieval system