KEGG   Shewanella baltica OS678: Sbal678_3000Help
Entry
Sbal678_3000      CDS       T01725                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sbt  Shewanella baltica OS678
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sbal678_3000
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Sbal678_3000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3499653..3500231)
Genome map
AA seq 192 aa AA seqDB search
MAQLYFYYSSMNAGKSTSLLQSSYNYRERGMNTLVMTASIDDRYGKGKVASRIGIETEAQ
VFSSQDDLTQMISDVHQATPLSCVLVDECQFLSKEQVKQLTHVVDNIDIPVLCYGLRTDF
QGELFSGSHYLLAWADKLVELKTICHCGRKANMVVRLDGDGKVMREGEQVAIGGNESYES
VCRKHFREFIWD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttggcacaattgtatttttattattcgtcgatgaacgcgggtaaatccacttccctatta
cagtcatcctataattaccgcgaacgcggtatgaataccttggtgatgacagcctccata
gatgacagatatggcaaaggtaaagtggcttcgcgtatcggtattgaaaccgaagcacag
gtttttagtagccaagatgatctgactcagatgattagcgatgtgcatcaagccacgcca
ttaagttgtgtgttggtggatgagtgccagtttttgagtaaagaacaggtaaagcagctg
acgcatgtggtcgataatattgatattcccgtactctgctatggcctaagaaccgatttc
caaggtgaactctttagcggcagtcattatttattagcgtgggccgataagttggttgag
ctgaaaaccatttgccattgtggccgcaaagccaacatggtggtgcgcctcgacggtgac
ggcaaagtgatgcgcgagggtgaacaagtggcgattggcggtaatgaaagctacgagtcc
gtttgccgtaaacattttcgtgagtttatctgggattag

DBGET integrated database retrieval system