KEGG   Shewanella baltica OS678: Sbal678_3058Help
Entry
Sbal678_3058      CDS       T01725                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sbt  Shewanella baltica OS678
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal678_3058
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sbal678_3058
Enzymes [BR:sbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sbal678_3058
Two-component system [BR:sbt02022]
 CheA family
  CheA-CheYBV
   Sbal678_3058
Bacterial motility proteins [BR:sbt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sbal678_3058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3566293..3567420)
Genome map
AA seq 375 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVREIMAKCPTPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDDAIL
LLQQRVKALGRRRMFRPIARPVVASTPSVRPTSSVLGTTSIASHTPATAPVRTSTAASIR
ASGKQYKILLIGTSTGGPVALQKILTQFPANYPHPILLIQHMPAAFTPAFASRLNGLCKI
EVKEAANGDLLKPGCAYLAPGGMQMMVERTGGSGRLKVIAGSADMNYKPCVDITFASASK
AFSGDVLAVVLTGMGADGREGARMLKAVGATIWAQDEASCVVYGMPQAVASAGIATQSIA
LDNMAECILKESVRV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagtattagtcgttgatgactcaagttttttcagacgacgtgttagtgaa
atagtcaatcaagatcctgaactggaagttatcgcgacggcctcaaatggggccgaagcg
gtgaagatggctgctgagcttaatcctcaagttatcactatggatattgagatgcccgtg
atggatggcattactgccgtccgtgaaatcatggctaaatgtccgactccgatcttgatg
ttttcttctttaacccatgatggcgctaaagcgacgttagacgctttagatgctggtgcg
ttagattttctacctaaacgttttgaagacattgctaccaataaagatgatgctatttta
ttgttgcagcagagagtgaaggcattgggacgccgcagaatgtttcgtccaattgcacgt
cctgtcgtcgcttcaacacctagcgtgcgtccaacaagtagcgttttagggacaacgagt
atagcgtcgcatactcctgccactgctcctgtgaggacctcaacagcagcgtcgattcga
gcaagtggtaagcagtataaaatactgctgatcggcacatctactggtggcccagttgcc
ttgcaaaaaattcttacccaattcccggcaaactatccgcatccgattttattaatccag
catatgcctgcagcttttacgccagcatttgcaagtcgtttgaatggcttatgtaagatt
gaagtaaaagaggccgctaatggcgatcttcttaaaccgggttgtgcatatttagcgcct
ggcggtatgcaaatgatggttgaacgtactggaggtagtggtcgattaaaggtcatcgct
ggtagtgcggacatgaactataagccttgtgttgatatcacctttgcttctgcctctaaa
gcctttagtggtgacgtacttgccgttgtgttaaccggtatgggcgcggatggcagagaa
ggtgcccgcatgttgaaagcggtcggtgcgaccatttgggcacaggatgaagccagttgt
gtggtttatggtatgcctcaggctgtcgctagtgcaggtattgccactcagtcgattgcc
ttagacaacatggctgaatgcattttaaaagagtctgttcgtgtctaa

DBGET integrated database retrieval system