KEGG   Shewanella baltica OS678: Sbal678_3186Help
Entry
Sbal678_3186      CDS       T01725                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbt  Shewanella baltica OS678
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sbal678_3186
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sbal678_3186
Enzymes [BR:sbt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sbal678_3186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3700475..3701167)
Genome map
AA seq 230 aa AA seqDB search
MGCFLLVSLDFRSAQSVLLHRYAVVNHSFYFLIQYDLYLVRLRNVPVKEKAMKKLPMIFA
MTASLMSVSAMAATCPEYLNLEVRKLHSEETVNLCELTQGKPVLIVNTASNCGYTPQFKA
LEALHENYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLSTSAVRGSDANS
VFKYLAEKTGAPKWNFYKYVVSGDGAVVQQFNSKVKPDSEELKQAIESVL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctttttgttggtgtcgttagattttcgttcagctcaatcggttttacttcat
cgctatgcggtcgttaaccatagcttttattttttaattcaatatgatctttacctagta
cgtttacgtaatgtaccggtaaaggagaaagcaatgaaaaaattacctatgatattcgct
atgactgcgagcttgatgagtgttagcgctatggcggccacttgtcccgagtatttgaac
cttgaagtacgaaaattacattctgaagagacagttaatctgtgtgaattgactcaggga
aagccagtgttgattgttaacactgcaagtaactgtggttacaccccgcagtttaaagcg
ctcgaagcattgcatgaaaactataaagacaaaggcttagtggttattggtttcccatcg
gatgattttttccaagaagaaaatgatgagaaagacacggctaaggtgtgttacatcaat
tacggtgtcactttcactatgttgtcgacttcggctgtgcgtggcagtgacgccaatagc
gtatttaaatacttagccgagaaaaccggtgcgcctaagtggaatttctacaagtatgtc
gttagcggcgatggcgcggttgtgcaacagttcaattctaaagtgaagccagatagcgaa
gagcttaagcaagcaatagaatctgtactttaa

DBGET integrated database retrieval system