KEGG   Shewanella baltica OS678: Sbal678_3270Help
Entry
Sbal678_3270      CDS       T01725                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sbt  Shewanella baltica OS678
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sbt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sbt00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sbt03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sbt03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sbt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3786627..3787130
Genome map
AA seq 167 aa AA seqDB search
MTQVLFYLMPPVASIAKAKADSPVATANANPALCEMYLLACQLAQQAFVKQQWVYIHCQD
KQQAHAIDELLWQFEPSAFVPHNLKGEGPMTGSPVEIGFDRLGANKSRQVLINLADQAPP
FAVNFGHIIDFVANDDQHKAVARERYRQYRGLGVNLQTQDLATHPLN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtgctgttttatctcatgccgccagtggcatcaattgccaaagctaaggct
gattcacctgttgcaaccgcgaatgcgaaccctgcgctttgcgagatgtatcttctggca
tgccaactggcgcagcaggcttttgtgaaacaacaatgggtctatatccattgccaagat
aagcagcaagcccatgcgattgatgaacttttatggcagtttgagccaagtgcctttgta
cctcataaccttaaaggtgaaggcccgatgacgggatcgccggtagaaattggttttgat
cgcctcggcgccaacaaaagtcgccaagttctgattaatcttgcagaccaagcgccccca
tttgcggtaaactttggccacattatcgattttgttgccaatgacgatcagcataaagcg
gtcgctcgcgaacgttatcgacagtatcgcggcttaggggtcaatttacagacccaagac
ttagcaacacatccacttaattag

DBGET integrated database retrieval system