KEGG   Shewanella baltica OS678: Sbal678_3372Help
Entry
Sbal678_3372      CDS       T01725                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sbt  Shewanella baltica OS678
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sbt00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3921939..3923270)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALSSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLGLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIQGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNEADARAKL
NRVLDNGRAAELFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADMQGYAYSMDTRELG
LAVVTLGGGRRKPGDTLDYSVGLTQVCALGDKVDSSTPIAVIHAQSEAAFAEAELAVKKA
IHIGETAPEKTPEIYAYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctaagttccgaa
gaaatacagttctttgttcaaggtatcaccaccaactctgtatctgaaggtcagatcgcc
gcattaggtatggcggtgtattttaatgacatgaatatggatgaaagaatcgctttaacg
acagcaatgcgtgattctggcactgtgcttaattggcaatcattgggactcaacggtcct
gtcatcgacaaacacagcactggtggtgtcggcgatgtgattagtctcatgcttggccct
atggctgcggcgtgtggcggttatgtgcctatgatttctgggcgcggcctaggtcatact
ggcggtacactcgataagtttgatgccattcagggttaccaaactgagccttcaagtgaa
ttgttccgcaaagtggttaaagaagtcggggtggcgattattggccaaacgggcgatctc
gtccctgccgataaacgcttctattctattcgcgataataccgccaccgttgaatccatt
tccctcatcactgcgtcgattctgtctaagaaattagcctgtaatttagatgcgttggcg
atggacgtaaaagttggtagcggcgctttcatgccaacctatgaggcatcggaagaatta
gctcgcagtatcgccgccgttgcaaatggcgcgggtactaaaacgacggctttacttacc
gatatgaatcaagtgcttgcatcttgtgcaggtaacgcggttgaagtgaaagaagccatc
gactttttaacgggtgcttaccgtaacccgcgtttatatgaagtcactatgggtctttgc
gctgagatgttgcttctgggcggtcttgcaagcaatgaagccgatgctcgcgctaaactg
aatcgtgtactcgataatggtcgcgctgcagaactctttggcaagatggtgtcgggtctt
ggtggtccggttgattttgttgaaaactacagtaaatacctaccacagtcacaaattatt
cgcccagtttttgccgatatgcaaggttatgcctacagcatggatacccgtgagttaggt
ttagcggttgtgaccttaggtggcggccgccgtaagcccggcgatacactagactatagt
gttggcttaacccaagtgtgtgccctaggcgataaagtggattcatcgacgccgattgcc
gttatccatgcacagtctgaagccgccttcgcggaagcggaacttgcggtgaaaaaagcg
attcacattggtgaaaccgctccagaaaaaacacctgagatctatgcctatattcgtgca
tcggatctttaa

DBGET integrated database retrieval system