KEGG   Shewanella baltica OS678: Sbal678_3438Help
Entry
Sbal678_3438      CDS       T01725                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sbt  Shewanella baltica OS678
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3988387..3989220)
Genome map
AA seq 277 aa AA seqDB search
MFELIAGTKRLALSSPIVMGILNITPDSFSDGGQYSSYELACQHADDMVAQGAGMIDIGG
ESTRPGAAEVSLADELARVIPLVKYVATHHDVWISVDTSKAEVMRQAVAAGAHLINDVRA
LMEPGALEAAAELHVPICLMHMQGEPKNMQSSPIYYDVIEEVSGFLTERIDACIQAGIPR
ELLILDPGFGFGKSLEHNYELLAKLDSFTKFDLPVLIGLSRKSMIGNLLAKPTSERLAGS
LAGAMIAAQKGAHIIRVHDVAETVDMLKVLQATQAYF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaactgattgctggcactaaacgcctcgcgttatcttcgcccatagtgatgggc
attctgaatatcactcccgattccttttccgacggtggtcaatattcttcctatgaactt
gcctgtcagcatgccgatgacatggtggctcaaggcgcagggatgattgatattggtgga
gagtcgacaaggcccggcgccgccgaggtgagcctagccgatgaacttgcgcgggtgatc
ccgttagtaaaatatgtggcgacgcaccatgatgtgtggatttcggtcgataccagtaaa
gctgaagtgatgcgccaagctgtcgctgcgggtgcacacctgattaatgatgtgcgtgcc
ttgatggaacccggtgcgctcgaagctgccgcagagttgcacgtcccgatatgcctaatg
catatgcagggtgagccgaagaacatgcagtcttcgccgatatattatgatgttattgaa
gaagtttctggctttttaaccgagcggattgacgcttgcatacaagctgggatcccccgt
gaattactcatactcgatccgggatttggctttggtaaaagcttagaacataactatgaa
ttactggccaagctcgactcttttaccaagtttgatttacccgtattgataggattgtct
cgtaagagcatgatagggaacctcttagcaaaaccgacctcagagcgtcttgctgggagc
cttgctggcgctatgatagcggcccaaaagggagctcatatcattcgcgtacatgatgtt
gctgaaactgtggatatgctcaaggtgttacaagcgacacaagcgtatttttaa

DBGET integrated database retrieval system