KEGG   Shewanella baltica OS678: Sbal678_3563Help
Entry
Sbal678_3563      CDS       T01725                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbt  Shewanella baltica OS678
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal678_3563
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sbal678_3563
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Sbal678_3563
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sbal678_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4111873..4112991)
Genome map
AA seq 372 aa AA seqDB search
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMKSGVEVVLCTSGAIAAG
REHLQYPTLPDTMANKQLLAAVGQSQLILAWSQLFSIYGLHVGQLLLTRADLQDRERYLN
ARDTLNALLANNIVPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVVKIDDSLRMLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVSKESVGTHFSAIENPLESRKQWILAGPATQGSLVLDAGAVKAVTDKGRSL
LSKGIVGVKGQFERGATLQLVDQQGKVIAKGMTRYCGQALSLIAGKHSDEIESLLGYDYG
DAIVHRNDMVVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaagtgagattgcgtatcgccgcgtagtagtgaaattggggacgagtgtgctg
acctctggcagtaaacagctagataaagcccacatggttgagcttgctcgtcaaatggcc
gcactgatgaagtcaggggtcgaagtcgtattatgcacctctggggccattgccgctggg
cgtgaacatctccaatacccgacactgcccgacactatggccaataagcaattgttagcc
gctgtcgggcaaagtcagttgatcctcgcttggtcacaactctttagtatttatgggctg
catgtcggccaattgctgctgacccgtgccgatttgcaggatagggagcgttaccttaac
gcccgcgacacgcttaatgccttgctggcgaataatattgtgccgatcatcaatgaaaac
gatgccgttgccactaatgaaatcaaagtcggtgataacgacaatctgtcggcccgtgcc
gcactgctgtgtgatgctgacttattgattttattgacggatcaaaagggcttatttgat
gccgatccgcgcacgaacccgaatgctaagttgatctcccaagtcgtcaagattgacgac
agcctacgtatgttggcgggcgggtctgtttctggtttaggtacgggcggaatgtcgact
aaattggaagcggcggatattgctcgccgtgcaggcatcgaagtggttatcgcctctggc
catcacccagatgtgattaaaaaagtggtgagcaaggaatccgttggcacgcattttagt
gccatcgaaaacccgctcgaaagccgtaaacagtggattttagccggccctgcgactcaa
ggttctttagtgcttgatgcgggcgcagtcaaagccgtgacagacaagggccgcagccta
ttgtccaaaggtatcgtcggcgttaaaggccagtttgagcgcggcgcaacgctgcaatta
gttgatcaacaaggtaaagtgattgctaaagggatgacacgatactgcggccaagccctc
agtttgatcgcgggcaagcattccgacgagatcgagtctttactcggttacgattatggt
gacgcaatcgtgcaccgcaacgacatggttgttttataa

DBGET integrated database retrieval system