KEGG   Shewanella baltica OS678: Sbal678_3665Help
Entry
Sbal678_3665      CDS       T01725                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sbt  Shewanella baltica OS678
Brite
Enzymes [BR:sbt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sbal678_3665
Secretion system [BR:sbt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sbal678_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4241509..4242234)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKLFHGSLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacccgagcattatctttaatttttgcccttgttgtagctcctcttgctcac
gccgcaacagcgacctcgccagataccgctgctattaagcaaaaactgactgagatgttg
gatgttgaagtcatttctatgcaggattcgccgattgagggtttgtatcaagccatgact
aaccgcggcgtgctctatattagtcgtgatggatcaaaactgttccacggcagtttgtat
gacctagataaaggcatgaaaaacttaacggaagcagcattagctggcccacgtttagaa
atgatgaagccgcttgaagaccatatgttggtttacaaagctaaaaacgaaaaacacgtg
gtcactgtatttaccgacgtcagctgtggttattgccgtaaattgcacagccaaatggcc
gattacaacaagcttggcattaccgtgcgttacttagccttcccgcgtgcgggcgtgccg
tcagccaacgccgacgaaatgcaagccatctggtgtgctaaagatccattaaaagccatg
acagacgctaaagcaggcagcaaagttgctgcagcaacatgcgatgctaaaattgccgag
caatatgctttaggcaccacctttggggtgaatggtacgccggcaatcgtgttagaagat
ggcaatatgatcccaggttatcaaccccctgcggacttattacgcaccttagaagcgcgt
cagtaa

DBGET integrated database retrieval system