KEGG   Shewanella baltica OS678: Sbal678_3768Help
Entry
Sbal678_3768      CDS       T01725                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbt  Shewanella baltica OS678
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sbt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4354569..4355423
Genome map
AA seq 284 aa AA seqDB search
MPAAISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDYCDMLDFKVTETPELILHSN
MSGVVADSDNLILRAAKSLQQTTGFNGGAEIWLDKRLPMGGGLGGGSSDAATTLVALNTL
WHTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGVGERLQAVNPSEPWYLVIAPDAHVST
ADVFQDPLLPRDTPKLAIDTLMSQPWANDCQKLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFTQQQQALAALAKLPSEMQGFVAQGMNLSPLITRLSHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgcaatttcccgcaattggcctgcgccagccaagctcaacttgtttttacac
attaatggccgccgcgccgacggttaccacgaactgcaaaccttgtttcagtttatcgat
tactgcgacatgctcgattttaaggtcactgaaacccctgaactgattttgcactccaat
atgtcgggcgttgtcgctgacagcgataacttaattctgcgagccgcaaaatcattacag
caaaccacgggctttaacggtggcgctgagatctggctggataaacggctgcccatgggc
ggcggtttaggcggcggctcgtccgatgctgcgaccacattagtggcattgaacacgtta
tggcatacccaattatcgaccgaagaattggctaaaatcggccttaaattgggtgccgat
attcctgtttttattcatggtttcgccgcttttgccgaaggtgtgggtgaacgcttacaa
gcagtaaatccgagtgagccttggtacttagtcatagcacccgatgcccatgtttccacc
gccgacgtattccaagatccacttttaccgcgtgataccccgaaactggccatagatacc
ttaatgagccaaccttgggcaaatgattgtcaaaaactagtcgtttctaaataccctcaa
gttgccaaggcattaggctggctgctagaatatgcgccgtcgagaatgacaggaacaggc
gcatgcgtgttcggggaattcacacaacagcaacaagctctcgcagccttggcgaaatta
ccgtctgaaatgcaaggatttgttgcacaagggatgaatctttcgccgctcatcacgcga
ctcagtcacccttaa

DBGET integrated database retrieval system