KEGG   Shewanella baltica OS678: Sbal678_3768Help
Entry
Sbal678_3768      CDS       T01725                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00900  Terpenoid backbone biosynthesis
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sbal678_3768
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Sbal678_3768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADT95900
JGI: Sbal678_3768
Position
4354569..4355423
Genome map
AA seq 284 aa AA seqDB search
MPAAISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDYCDMLDFKVTETPELILHSN
MSGVVADSDNLILRAAKSLQQTTGFNGGAEIWLDKRLPMGGGLGGGSSDAATTLVALNTL
WHTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGVGERLQAVNPSEPWYLVIAPDAHVST
ADVFQDPLLPRDTPKLAIDTLMSQPWANDCQKLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFTQQQQALAALAKLPSEMQGFVAQGMNLSPLITRLSHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgcaatttcccgcaattggcctgcgccagccaagctcaacttgtttttacac
attaatggccgccgcgccgacggttaccacgaactgcaaaccttgtttcagtttatcgat
tactgcgacatgctcgattttaaggtcactgaaacccctgaactgattttgcactccaat
atgtcgggcgttgtcgctgacagcgataacttaattctgcgagccgcaaaatcattacag
caaaccacgggctttaacggtggcgctgagatctggctggataaacggctgcccatgggc
ggcggtttaggcggcggctcgtccgatgctgcgaccacattagtggcattgaacacgtta
tggcatacccaattatcgaccgaagaattggctaaaatcggccttaaattgggtgccgat
attcctgtttttattcatggtttcgccgcttttgccgaaggtgtgggtgaacgcttacaa
gcagtaaatccgagtgagccttggtacttagtcatagcacccgatgcccatgtttccacc
gccgacgtattccaagatccacttttaccgcgtgataccccgaaactggccatagatacc
ttaatgagccaaccttgggcaaatgattgtcaaaaactagtcgtttctaaataccctcaa
gttgccaaggcattaggctggctgctagaatatgcgccgtcgagaatgacaggaacaggc
gcatgcgtgttcggggaattcacacaacagcaacaagctctcgcagccttggcgaaatta
ccgtctgaaatgcaaggatttgttgcacaagggatgaatctttcgccgctcatcacgcga
ctcagtcacccttaa

DBGET integrated database retrieval system