KEGG   Shewanella baltica OS678: Sbal678_3800Help
Entry
Sbal678_3800      CDS       T01725                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sbt  Shewanella baltica OS678
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sbal678_3800
Enzymes [BR:sbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Sbal678_3800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4393041..4393952
Genome map
AA seq 303 aa AA seqDB search
MSQILVIGSANADHVMKFEYLPAAGQTLMSRDYRLELGGKGANQAVACARLAKPGTRTDF
ICHLGQDSIGDDMRQSWIKDGISTEGISQVAEQSTGTAMIFIGDNGENTIGVAAGANATL
SPDDLEHHYALFANAQYLLAQLETPAATVAKALKMAKNLGVTTVLNPAPATALGHDVLKW
VDVITPNETEAEALTGVEINHLDDAQMAAQLLHQQGVGIVVITLGSRGAYISSPGFTGLV
PALEVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTRQGAQRAIPYRQE
LSY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatactcgttatcggcagtgcaaatgccgatcatgtgatgaaatttgagtac
ctgcccgcagcagggcaaaccttgatgagccgagattatcgcctcgaactgggcggcaaa
ggtgccaaccaagccgtcgcctgcgcgcgcttagccaaaccaggcacccgtactgacttt
atctgccacctcggccaagacagtatcggcgatgatatgcgtcaaagctggattaaagat
ggcataagtacagaaggaattagccaagtagcggagcagagtaccggcacagcgatgatt
tttatcggtgacaacggtgaaaataccattggtgttgctgcgggtgccaacgccactctt
tcacccgatgatttagaacatcactatgctctgtttgctaatgctcagtacttattagca
caattagaaacccctgctgccacagtggcaaaagcgctaaaaatggccaaaaatcttggt
gtgacgacggtattaaatcccgctccagcgaccgcccttgggcacgatgtactcaagtgg
gtcgatgttattacgcctaatgagacagaagcagaagccttaacaggcgttgaaattaat
catctcgatgatgcccaaatggctgcgcagctcctccaccagcaaggtgtagggattgtg
gtgatcactttaggcagtcgaggcgcatatatcagcagcccaggttttactgggctagta
cccgcgcttgaagtgcaagccatagacacagtcgccgcaggagataccttcaacggcgcc
ttagtcgttggcttgagcgaaggcatgtcgattgccgccgccgttggatttgctaatgcg
gccagtgccattactgtgactcgccaaggcgcacagcgtgctatcccatatcgacaggag
ctttcgtactaa

DBGET integrated database retrieval system