KEGG   Shewanella baltica OS678: Sbal678_4086Help
Entry
Sbal678_4086      CDS       T01725                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00010  Glycolysis / Gluconeogenesis
sbt00020  Citrate cycle (TCA cycle)
sbt00620  Pyruvate metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt01130  Biosynthesis of antibiotics
sbt01200  Carbon metabolism
Module
sbt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal678_4086
   00020 Citrate cycle (TCA cycle)
    Sbal678_4086
   00620 Pyruvate metabolism
    Sbal678_4086
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sbal678_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RnfC_N PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ADT96214
JGI: Sbal678_4086
Position
complement(4730920..4732917)
Genome map
AA seq 665 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICVAVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAAAPAPVAAPAQAAPASAPVQAAPAPVAAAPATGATKV
VEVTVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKDVKVAV
GDKVSQGSLVIMLEVGGAAPAAAPTVAAQAAPAAMVAPVAAAPAAPAASVVAVKEIQVPD
IGDASNVDVIEVLVSVGDEITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKVSQG
SVIATIETVTVGAAPAAVAQAAAPAPVSAAPVAAPTPASRPPVPHHPSAGTPLSTGAVHA
SPAVRRLAREFGVDLTQVAGTGRKGRIMREDVQAYVKYELSRPKATAATSVGSGNGGGLQ
VIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRKQQN
DVAAKKKADYKITPLVFMLKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVDTPNG
LVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIV
NYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGILSDI
RTLVL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtgcaagtgatc
gaaatttgtgtggctgtgggtgataccctagcggcagaagaatcgattcttaccgtcgaa
agcgacaaggcgactatggatattccagcgcctttcgccggtgttttagccgaattgaaa
gtggcggtgggcgataaagtatctgaaggtactttgattgctatgatgcaagcggcgggc
gcggcagctgccgctccggctccagttgcagcacccgctcaggcggcaccagcatctgca
ccagttcaagcggctccagccccagtggctgctgctcctgcgacgggcgcaaccaaagtg
gttgaagtgactgtacctgatatcggtggcgacactgatgtatcggttatcgaagtcctg
gttgctgtcggtgacaagattgaagttgatagcggtttaattaccctagaaacagacaaa
gcgacgatggacgtgccatcacctttcgcgggtgtggttaaagacgttaaagtcgcagtt
ggcgataaagtgtcgcaaggctctttagtcatcatgcttgaagttggcggcgctgcacct
gcagccgcgccaacggttgctgcccaagcggctcctgccgctatggtagcgccagtggcc
gcagcacctgctgcaccagcggcaagtgtggttgcggtaaaagaaattcaagtgcctgat
attggcgatgccagcaatgtcgatgtgatcgaagtgctcgtgtctgtcggtgatgaaatc
actgctgaccaaggtttgattacccttgaaactgacaaagccaccatggaagtgcctgcg
ccattcgccggtaaactgctgtctttgactgttaaagtgggtgacaaggtttctcaaggt
agcgttattgcaacgattgaaactgtcacagtgggtgcagctccagcagcggttgctcaa
gcggcagctcctgctccagtgagcgcggcgcccgttgcagccccaacaccagcaagccgt
cctccagtgccacaccacccaagcgcaggtacgcctttgtctaccggtgcggtacatgcg
tctcctgcggtacgtcgtttagcccgtgaatttggtgtcgacttgacccaagttgctggt
actggccgtaaaggtcgcattatgagagaagacgttcaggcgtatgtgaaatacgaactg
tctcgtccgaaagcaactgcggcaacctctgtgggttcaggtaacggcggcggtctgcaa
gttattgcagcacctaaagttgatttcagtaagtttggtgaagtggaagaaattccatta
agccgtatccagaagatttctggccctaacttacaccgcaactgggtaactattccgcac
gtgactcagttcgatgaagctgatatcactgaaatggaagagttccgtaagcagcaaaac
gatgtagcggcgaagaagaaagccgattacaagatcacgcctttagtgtttatgctaaaa
gctgtggctaaaacgttgcaacagttcccagtgttcaactcaagcttaagtagcgatggc
gaatcactgatccagaagaagtatttccatatcggtgtggcggttgatacgccaaacggt
ttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgagttatctcgtgaa
ctggctgatatctctatccgtgcccgtgatggcaagctgaaatctgctgacatgcaaggt
agctgttttactatttctagtttaggtggcattggcggtacagcgtttacgcctatcgtt
aactacccagacgtggcgattttaggtgtgtctaaatctgaaattaagcctaagtggaat
ggtaaagagttcgaacctaaattgatgttgccattgtcgctgtcatacgatcaccgtgtg
atcgatggtgctatggctgcacgctttagtgtgacgctgtcaggaattctgtccgatatt
cgtactttggttctgtaa

DBGET integrated database retrieval system