KEGG   Shewanella baltica OS678: Sbal678_4464Help
Entry
Sbal678_4464      CDS       T01725                                 

Definition
(GenBank) Malate synthase family protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbt  Shewanella baltica OS678
Pathway
sbt00620  Pyruvate metabolism
sbt00630  Glyoxylate and dicarboxylate metabolism
sbt01100  Metabolic pathways
sbt01110  Biosynthesis of secondary metabolites
sbt01120  Microbial metabolism in diverse environments
sbt01200  Carbon metabolism
Module
sbt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal678_4464
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal678_4464
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal678_4464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2431 Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADT96587
JGI: Sbal678_4464
Position
5183814..5184377
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVTEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMIVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtcaatgtcaccgagcacgagaagatcgctaatgcg
aaacaattcctcgaccgcctctttccacttaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgttggccttttttgccgacggcagccacagtggttta
cgtcagccaaaacagtttgtggcctttaacggcactaaagatgcgccttgcgccatagtg
ttgcaggacctaggttgccacgttgaactcagtttcgaccgcaatggcatgataggggcg
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatgatagtcgga
acaccagagtcacgttcagccgcatcgcgccattggctcagcctattacatgcgggtatg
tctagcgctaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system