KEGG   Shewanella baltica OS678: Sbal678_4464Help
Entry
Sbal678_4464      CDS       T01725                                 

Definition
Malate synthase family protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbt  Shewanella baltica OS678
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal678_4464
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal678_4464
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal678_4464
Enzymes [BR:sbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal678_4464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5183814..5184377
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVTEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMIVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtcaatgtcaccgagcacgagaagatcgctaatgcg
aaacaattcctcgaccgcctctttccacttaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgttggccttttttgccgacggcagccacagtggttta
cgtcagccaaaacagtttgtggcctttaacggcactaaagatgcgccttgcgccatagtg
ttgcaggacctaggttgccacgttgaactcagtttcgaccgcaatggcatgataggggcg
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatgatagtcgga
acaccagagtcacgttcagccgcatcgcgccattggctcagcctattacatgcgggtatg
tctagcgctaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system