KEGG   Shewanella baltica OS678: Sbal678_4525Help
Entry
Sbal678_4525      CDS       T01725                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sbt  Shewanella baltica OS678
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sbal678_4525
Enzymes [BR:sbt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal678_4525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5251546..5252529
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKK
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKAFVRWLASKL
DTTLNDGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAYRELYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
AYRNQALNYALDFFKRFAIKDEDKQAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcgactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaagcgttgttcaagacacgctgatcacagctgatggcatcacgctggct
tatatgatggtcaaacatccccaagcacataccgcaatcgttctcagcagtggccgagtt
gaatcctatttaaagtatcaagaattggtcttcgacttataccaacagggttactcagtt
tatgccatcgatcaccgtggccaagggctgtcggatcgtatgacaatcaatccgcacatg
ggtcatgtgcgaagatttaatgattatattgatgattttgcactgtttatgcagaagaaa
gtgttaccgcaaaacgacaaacagctcatgctactcggtcattcaatgggtggtgcgatt
ggcactttgtatctcaaacagcatcccgatatttttaccgccgcggcattttcagcgccc
atgtatggcatcaaattacctatgccaaaagcattcgtgcgctggttagccagtaagctc
gataccactctcaatgacggcgaacctaactatgtgcttggaggacagaactataaaccg
gttcccttcaaaggaaatgagctaacccattgccaaagtagataccaagcctatcgagag
ctgtatgacgcggcccctaagttacaactcggttccccaactaaccgttggttgacagaa
tctttagatgcagcagacacttgcgtactggcaacagcgcaaattcgcacgccgatcctg
atactgcaagcgagtgaagataagattgttgataatgcggcccagaatcttgcagtgagc
actcattgccaattgaaggtgatagcaggggctgcccatgagatttttatggaaaaagac
gcctatcgaaaccaagccttaaattatgccctcgacttctttaaacgcttcgcaataaag
gacgaggacaaacaagctggataa

DBGET integrated database retrieval system