KEGG   Spirochaeta sp. Buddy: SpiBuddy_0125Help
Entry
SpiBuddy_0125     CDS       T01439                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbu  Spirochaeta sp. Buddy
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sbu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
144891..146567
Genome map
AA seq 558 aa AA seqDB search
MCGFVGMFDIRSYTPQLRSQVLAMSRKIRHRGPDWSGVFASEKAVISHERLAIVDPLSGG
QPLYSKDRNIVLAVNGEIYNHQQIRKHYADTYEFQTQSDCEVILALYQDKGPDFLEELNG
IFAFALYDQEKDVFLIARDHIGIIPLYQGWDDEGHYYVASELKALEGVCSSIELFLPGQY
FYSPDGKPKQWYSRSWTSYDVVKEHGGSIEEVKHALEAAVKRQLMSDVPYGVLLSGGLDS
SIIAAITAQYAQKRVESDDQETAWWPRLHSFAIGLEGSPDLKAARIAAAYLKTVHHEVHF
TIQEALDALSDVIYHLETSDITTVRAATPMYLLGRVIKSMGIKMVLSGEGSDEIFGGYLY
FHKAPNAREFHEETVRKLSKLHLYDCLRANKSLAAWGVEGRVPFLDKEFMDVAMNLNPDL
KLCPIVGENKRIEKWLLREAFKDYLPPEITWRQKEQFSDGVGYNWIDTLKQMTANLVTDE
QFALASKRFPIHTPATKEEYYYRCLFASHFPSESAARCVPREDSVACSTAKALEWDEAFR
KMNEPSGRAISGVHESAY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggtatgtttgacattcgctcgtatacaccccagttgcgttcccag
gtcttggcgatgtcacgcaagattcgtcaccggggaccggattggtccggggtgtttgca
tcagagaaggcggttatcagccatgagcggctggccatcgtcgacccgttgtcgggaggt
caaccgctgtacagcaaagataggaatatcgtgttggccgtaaacggtgaaatctacaat
caccagcagattcgcaagcactacgccgatacctatgagttccagacccagagcgactgc
gaggtcattctcgccctgtaccaagacaagggccctgattttcttgaggagttgaacggt
attttcgcctttgcactctacgatcaggaaaaggatgtgtttctcatcgcccgcgaccat
atcggtattattcccctgtatcaaggatgggacgatgagggccattactatgtggcaagt
gaactcaaagccctggagggagtctgttcctccattgagctctttctgcccggtcagtat
ttctacagtcccgatggaaagcccaagcagtggtattcacgttcctggaccagctacgat
gtagtcaaagaacacggtgggagcatcgaggaagtaaaacacgcactcgaagcggcggtg
aagcgacagctgatgagcgatgttccctacggagtattgctttccggtggcctggacagc
tcgattattgcagccattaccgcccagtatgcccagaaacgtgtggagagcgatgaccag
gaaacggcatggtggcccaggctccactcctttgccatcggcctcgaaggctctcccgac
cttaaggcggcccgcattgcggcagcctaccttaagacggtgcaccacgaggtacacttc
accatccaggaagccctcgatgcgctgtccgatgtcatttatcatttggagaccagtgat
atcaccaccgtcagggctgcaaccccgatgtatctcctgggaagggtgattaagtcgatg
ggcatcaagatggtgctcagcggagagggaagcgacgagattttcggtggctatctctac
tttcacaaggctcccaatgcccgtgaatttcatgaggagacggttcgcaagctctccaaa
cttcacctgtatgactgcctcagggccaataaatcgcttgccgcctggggcgtggagggc
agggttcctttcttggacaaggagttcatggatgtggcgatgaacctgaatcccgacctc
aagctctgccctattgtcggggagaacaagcggatcgagaagtggttgctcagagaagcg
ttcaaggactatttgccgcctgagattacgtggaggcagaaggaacagttcagcgacggg
gttggatacaactggatcgatacgctcaagcagatgacggcaaacctcgtcaccgatgaa
cagtttgcccttgcttccaagcgctttcccattcatacccctgccaccaaggaggagtat
tactatcgctgtctgtttgcttcccacttccccagtgaaagtgctgcgcgttgtgttccc
cgtgaggactcggtcgcctgttcaaccgccaaggcgttggaatgggacgaggcgttcagg
aaaatgaacgagcccagcggccgggcgataagcggagtgcatgagtctgcctactag

DBGET integrated database retrieval system